SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004695498.1.68909 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004695498.1.68909
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily SIS domain 1.13e-67
Family mono-SIS domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004695498.1.68909
Sequence length 323
Comment MULTISPECIES: arabinose-5-phosphate isomerase [Veillonella]; AA=GCF_000024945.1; RF=representative genome; TAX=479436; STAX=29466; NAME=Veillonella parvula DSM 2008; strain=DSM 2008; AL=Complete Genome; RT=Major
Sequence
MTILEQAAQVLHEEARAIEELSSRLDHNFVNAVNMILACKGRVVCTGMGKSGHIGRKIAA
TLASTGTPALFMHPGEGVHGDLGMITEDDVVLAFSNSGETGEIISILPSLRRIGAKLICV
VGKPESTLAKNSDIVLLAEVEREACPLGLAPTTSTTVALALGDALAVCLLERHHFTPENF
AVFHPGGSLGRKLLLTVENIMHGGEDNPTVFKGATVRDALFVMTEKGLGATNVIDEEGHL
LGLVTDGDVRRGLDSGSNFLEWPVEDMMTSMPRTITKDKLAAEALHLMEKNQPRPITVLP
VVDTNNVCLGIVHITDLLRRGIV
Download sequence
Identical sequences A0A134BRZ0 D1BLH0 D1YQP7 D6KLW6 D6KSA6 T0UAF9 W1V2A4
479436.Vpar_0544 gi|269797607|ref|YP_003311507.1| WP_004695498.1.13496 WP_004695498.1.26527 WP_004695498.1.43318 WP_004695498.1.68909 WP_004695498.1.89407 WP_004695498.1.96711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]