SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004963339.1.84793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004963339.1.84793
Domain Number 1 Region: 133-398
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.98e-88
Family Enolase 0.00000139
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.98e-36
Family Enolase N-terminal domain-like 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004963339.1.84793
Sequence length 401
Comment MULTISPECIES: enolase [Haloarcula]; AA=GCF_000337755.1; RF=na; TAX=662475; STAX=244363; NAME=Haloarcula californiae ATCC 33799; strain=ATCC 33799; AL=Contig; RT=Major
Sequence
MTLITDIRLRRVLDSRGNATVEADVLTESGGFGRGKAPSGASTGEYEAIELPANEAIAKA
REEALPRLIGEVHAGNQRDVDAALHAADGTDDFSGIGANSAVAISMAAAKAGADVLGAPL
YQHLGGTFRGNEYPTPLGNIIGGGEHAADATNIQEFLAAPVGAPSVEEAVFANAAVHQEV
HDILADRDLPAGKGDEGAWAPSVSDDEAFEIMDEAVETVADDFGFAISFGLDVAGAELYD
DEADGYVYDDGVKSTEEQIEYIAGKVEEYDLVYVEDPLDENDYEAFADLTAQVGDQTLVC
GDDLFVTNVERLQAGINADAGNSILIKPNQIGTLTDAVDAIELATASGYESVVSHRSGET
EDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIEDNAV
Download sequence
Identical sequences M0JTZ1 M0KL07 P29201
WP_004963339.1.69175 WP_004963339.1.82819 WP_004963339.1.84793 WP_004963339.1.89716 gi|55377005|ref|YP_134855.1| 272569.rrnAC0069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]