SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004998168.1.49683 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004998168.1.49683
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 6.67e-17
Family YhbC-like, N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 85-152
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 0.000000000000017
Family YhbC-like, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004998168.1.49683
Sequence length 161
Comment MULTISPECIES: ribosome maturation factor [spotted fever group]; AA=GCF_000284195.1; RF=na; TAX=1105108; STAX=35792; NAME=Rickettsia parkeri str. Portsmouth; strain=Portsmouth; AL=Complete Genome; RT=Major
Sequence
MQTIEQQIANVIEESLTDMGFELVLVKFKGVNPKVVEILIDSLNSEKISVEDCTKASRTI
SAILDVEDLIEAAYSLEVASSGLERPLVKFENYNRFLEREVKITLKELLNGKTRYQGKII
KAENNKIYLKCEEQEVLIDYDLIKNANLVLTEEVFKKLLKQ
Download sequence
Identical sequences A0A0F3QP75 C3PNX3 Q7P8W8
gi|229586875|ref|YP_002845376.1| gi|383484153|ref|YP_005393066.1| WP_004998168.1.22823 WP_004998168.1.24793 WP_004998168.1.29537 WP_004998168.1.3533 WP_004998168.1.42246 WP_004998168.1.47675 WP_004998168.1.49683 WP_004998168.1.95812 347255.RAF_ORF0746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]