SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005063177.1.92927 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005063177.1.92927
Domain Number 1 Region: 4-482
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.66e-195
Family Heme-dependent catalases 0.000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005063177.1.92927
Sequence length 487
Comment catalase [Mycobacterium abscessus]; AA=GCF_900138505.1; RF=na; TAX=1962118; STAX=36809; NAME=Mycobacterium abscessus subsp. massiliense; strain=1177; AL=Scaffold; RT=Major
Sequence
MSNRTTTNTGIAVESDDESLTAGTQGPVLLHDHYLIEKLAQFNRERVPERIVHAKGAGAY
GELVITADVSKYTKAKLFQPGAKTESLARFSTVAGEQGSPDSWRDPRGFAVKFYTEDGNY
DLVGNNTPVFFIRDAIKFPDFIRSQKRLPGSGLRDHNMQWDFWTLRPETAHQVTWLMGDR
GIPKTYRHMNGYGSHTYQWINAEGERFWVKYHFKTDQGHDFLTQQEADELAGSDADAHRR
DLWNAIEEGNFPSWTLHVQIMPVDEAAGYRFNPFDLTKVWSKKDYPLIEVGKWTLNRNPR
NYFVEIEQAAFEPSNIVPGIGFSPDKMLLGRVFAYADAHRYRIGTNYAQLPPNAPRAATV
NSYSKEGPMRYHFNDPEIPVYAPNSFGGPHADPEAAGDGGVWEFDGTAVRAGYIQHAEDG
DFVQAGTLVRDVLDDEQRARLAGNIVGHVLDGVSEPVLSRVFEYWKNVDPELGKAVEEGV
RAGLDAT
Download sequence
Identical sequences A0A0U0YFT6 A0A1T9E2J2
WP_005063177.1.10031 WP_005063177.1.100419 WP_005063177.1.100779 WP_005063177.1.101432 WP_005063177.1.101662 WP_005063177.1.10342 WP_005063177.1.10602 WP_005063177.1.10730 WP_005063177.1.11888 WP_005063177.1.125 WP_005063177.1.12695 WP_005063177.1.12850 WP_005063177.1.13439 WP_005063177.1.13518 WP_005063177.1.13703 WP_005063177.1.13789 WP_005063177.1.13890 WP_005063177.1.13978 WP_005063177.1.14802 WP_005063177.1.15406 WP_005063177.1.16250 WP_005063177.1.17023 WP_005063177.1.17246 WP_005063177.1.17823 WP_005063177.1.18231 WP_005063177.1.18667 WP_005063177.1.19143 WP_005063177.1.19257 WP_005063177.1.19356 WP_005063177.1.19500 WP_005063177.1.19688 WP_005063177.1.19799 WP_005063177.1.19932 WP_005063177.1.20137 WP_005063177.1.20903 WP_005063177.1.22055 WP_005063177.1.22116 WP_005063177.1.2268 WP_005063177.1.22795 WP_005063177.1.22807 WP_005063177.1.23296 WP_005063177.1.2360 WP_005063177.1.23947 WP_005063177.1.2412 WP_005063177.1.2448 WP_005063177.1.24564 WP_005063177.1.24973 WP_005063177.1.2523 WP_005063177.1.25468 WP_005063177.1.25535 WP_005063177.1.25672 WP_005063177.1.25900 WP_005063177.1.2646 WP_005063177.1.26996 WP_005063177.1.27031 WP_005063177.1.27784 WP_005063177.1.28286 WP_005063177.1.2898 WP_005063177.1.30071 WP_005063177.1.30449 WP_005063177.1.30577 WP_005063177.1.31118 WP_005063177.1.31258 WP_005063177.1.31415 WP_005063177.1.32026 WP_005063177.1.32766 WP_005063177.1.33411 WP_005063177.1.33548 WP_005063177.1.33568 WP_005063177.1.33672 WP_005063177.1.33721 WP_005063177.1.34087 WP_005063177.1.34095 WP_005063177.1.34518 WP_005063177.1.34725 WP_005063177.1.35041 WP_005063177.1.35808 WP_005063177.1.3587 WP_005063177.1.36452 WP_005063177.1.36650 WP_005063177.1.36855 WP_005063177.1.36924 WP_005063177.1.37017 WP_005063177.1.37402 WP_005063177.1.37768 WP_005063177.1.37785 WP_005063177.1.37928 WP_005063177.1.38298 WP_005063177.1.38954 WP_005063177.1.39187 WP_005063177.1.39574 WP_005063177.1.39612 WP_005063177.1.39628 WP_005063177.1.39744 WP_005063177.1.39885 WP_005063177.1.40222 WP_005063177.1.40477 WP_005063177.1.41056 WP_005063177.1.41595 WP_005063177.1.41691 WP_005063177.1.42039 WP_005063177.1.42175 WP_005063177.1.42186 WP_005063177.1.42875 WP_005063177.1.42895 WP_005063177.1.43004 WP_005063177.1.43117 WP_005063177.1.43171 WP_005063177.1.43365 WP_005063177.1.43397 WP_005063177.1.43631 WP_005063177.1.45085 WP_005063177.1.45194 WP_005063177.1.45677 WP_005063177.1.45824 WP_005063177.1.46142 WP_005063177.1.46265 WP_005063177.1.46390 WP_005063177.1.46844 WP_005063177.1.46960 WP_005063177.1.47324 WP_005063177.1.47491 WP_005063177.1.47757 WP_005063177.1.47915 WP_005063177.1.48079 WP_005063177.1.48159 WP_005063177.1.4828 WP_005063177.1.48302 WP_005063177.1.48458 WP_005063177.1.48895 WP_005063177.1.48914 WP_005063177.1.4893 WP_005063177.1.49292 WP_005063177.1.4954 WP_005063177.1.50402 WP_005063177.1.50620 WP_005063177.1.50855 WP_005063177.1.50909 WP_005063177.1.51595 WP_005063177.1.5254 WP_005063177.1.52636 WP_005063177.1.5267 WP_005063177.1.528 WP_005063177.1.53120 WP_005063177.1.53358 WP_005063177.1.53468 WP_005063177.1.53765 WP_005063177.1.54149 WP_005063177.1.54326 WP_005063177.1.55601 WP_005063177.1.56143 WP_005063177.1.56609 WP_005063177.1.56938 WP_005063177.1.5792 WP_005063177.1.57967 WP_005063177.1.58256 WP_005063177.1.58716 WP_005063177.1.59544 WP_005063177.1.59946 WP_005063177.1.59947 WP_005063177.1.60260 WP_005063177.1.60273 WP_005063177.1.60354 WP_005063177.1.60456 WP_005063177.1.61063 WP_005063177.1.61125 WP_005063177.1.62556 WP_005063177.1.62827 WP_005063177.1.63790 WP_005063177.1.63965 WP_005063177.1.65216 WP_005063177.1.65615 WP_005063177.1.65825 WP_005063177.1.66000 WP_005063177.1.66859 WP_005063177.1.67337 WP_005063177.1.67981 WP_005063177.1.68014 WP_005063177.1.68035 WP_005063177.1.68419 WP_005063177.1.68968 WP_005063177.1.69075 WP_005063177.1.69092 WP_005063177.1.69956 WP_005063177.1.7004 WP_005063177.1.70111 WP_005063177.1.70212 WP_005063177.1.70479 WP_005063177.1.70925 WP_005063177.1.71152 WP_005063177.1.71190 WP_005063177.1.71374 WP_005063177.1.71775 WP_005063177.1.71968 WP_005063177.1.72320 WP_005063177.1.72851 WP_005063177.1.73632 WP_005063177.1.74063 WP_005063177.1.7414 WP_005063177.1.74413 WP_005063177.1.74493 WP_005063177.1.74505 WP_005063177.1.74662 WP_005063177.1.75495 WP_005063177.1.76353 WP_005063177.1.76789 WP_005063177.1.76842 WP_005063177.1.76870 WP_005063177.1.76949 WP_005063177.1.77270 WP_005063177.1.78055 WP_005063177.1.78213 WP_005063177.1.78391 WP_005063177.1.78665 WP_005063177.1.7922 WP_005063177.1.79843 WP_005063177.1.80323 WP_005063177.1.80912 WP_005063177.1.81953 WP_005063177.1.820 WP_005063177.1.82204 WP_005063177.1.8231 WP_005063177.1.82849 WP_005063177.1.82852 WP_005063177.1.83488 WP_005063177.1.83610 WP_005063177.1.84018 WP_005063177.1.84094 WP_005063177.1.84239 WP_005063177.1.84296 WP_005063177.1.84400 WP_005063177.1.84574 WP_005063177.1.84788 WP_005063177.1.84798 WP_005063177.1.85006 WP_005063177.1.85046 WP_005063177.1.8604 WP_005063177.1.86491 WP_005063177.1.86521 WP_005063177.1.86938 WP_005063177.1.88010 WP_005063177.1.88721 WP_005063177.1.89104 WP_005063177.1.89581 WP_005063177.1.9000 WP_005063177.1.91136 WP_005063177.1.9116 WP_005063177.1.91517 WP_005063177.1.91677 WP_005063177.1.91727 WP_005063177.1.91945 WP_005063177.1.9201 WP_005063177.1.92366 WP_005063177.1.92514 WP_005063177.1.92709 WP_005063177.1.92927 WP_005063177.1.9425 WP_005063177.1.94472 WP_005063177.1.94485 WP_005063177.1.94627 WP_005063177.1.94706 WP_005063177.1.94757 WP_005063177.1.9507 WP_005063177.1.96196 WP_005063177.1.96459 WP_005063177.1.96599 WP_005063177.1.96630 WP_005063177.1.97105 WP_005063177.1.97572 WP_005063177.1.97909 WP_005063177.1.98269 WP_005063177.1.9871 WP_005063177.1.98878 WP_005063177.1.99112 WP_005063177.1.99141 WP_005063177.1.99848 WP_005063177.1.99957 gi|397678430|ref|YP_006519965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]