SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005066947.1.13806 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005066947.1.13806
Domain Number - Region: 28-96
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz alpha-1 subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005066947.1.13806
Sequence length 111
Comment MULTISPECIES: hypothetical protein [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_000369025.1; RF=na; TAX=1217673; STAX=48296; NAME=Acinetobacter pittii ANC 3678; strain=ANC 3678; AL=Scaffold; RT=Major
Sequence
MKDYSEYFREAVASFLAQNPALQKELACITVDEAESIGTTVETLHSQVMNQRFVEHATQL
GIDTNHLVLQFIDASENEKNQILKNYHQNLANSLGIDWQDYISINPHLSHL
Download sequence
Identical sequences A0A009GP96 A0A1Y5NPD5 A0A255U673
WP_005066947.1.100086 WP_005066947.1.102059 WP_005066947.1.11037 WP_005066947.1.13806 WP_005066947.1.1416 WP_005066947.1.19750 WP_005066947.1.21609 WP_005066947.1.24916 WP_005066947.1.28277 WP_005066947.1.41946 WP_005066947.1.45158 WP_005066947.1.46114 WP_005066947.1.4733 WP_005066947.1.5089 WP_005066947.1.52030 WP_005066947.1.53076 WP_005066947.1.60144 WP_005066947.1.61879 WP_005066947.1.65556 WP_005066947.1.77264 WP_005066947.1.77776 WP_005066947.1.8300 WP_005066947.1.83187 WP_005066947.1.83504 WP_005066947.1.85359 WP_005066947.1.85831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]