SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005313226.1.51485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005313226.1.51485
Domain Number 1 Region: 549-1038
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-131
Family ALDH-like 0.00000046
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-111
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000314
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.14e-62
Family N-terminal domain of bifunctional PutA protein 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005313226.1.51485
Sequence length 1054
Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Aeromonas salmonicida]; AA=GCF_000931985.2; RF=na; TAX=29491; STAX=645; NAME=Aeromonas salmonicida subsp. salmonicida; strain=JF3224; AL=Scaffold; RT=Major
Sequence
MFKATQVLAADYIPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLEQVTQRARAL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANMLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSREKGYTHTYDMLGESALTLADADKYFGDYQRAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMSERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSDANRGWGKLGMVVQAYSKRALPVLCWLTALAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFISPQFATHNANT
VVCILEMAGDRQFEFQRLHGMGEELHNAVLNDHPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYTSLANDRIPQPVNLFSDRKNSSGVNMNI
VSIQRPFFARLKELESKQWLAGPIVDGETLKRSEARTVLSPQDVSQLVGKIHWADAQAVE
QALASAHAAFPRWRETPVSVRAAALEKLADLLEANREQFISLCTREAGKLLQDGIDEVRE
AVDFCRYYALQARGLMGQATLLPGYTGEQNELFLQGRGVFVCISPWNFPLAIFLGQVAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADARIGGVC
FTGSTETAKLINLTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAPRVLEILTGALQELKVGNPAEHNTDVGPVIDAEAKAGLDAHLAHM
IPRSRLIAQAPMPSATLAGHFVQPTALEIGSIRELVKEQFGPILHVVRYAARELDKVIAD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLGRFVTEKTRTINTTAVGGNASLLAMGDA
Download sequence
Identical sequences A0A1Q4MIU6 A0A248KTK4 A0A290VH15 A4SJ49
382245.ASA_0767 gi|145297828|ref|YP_001140669.1| WP_005313226.1.10171 WP_005313226.1.13540 WP_005313226.1.1406 WP_005313226.1.22899 WP_005313226.1.2366 WP_005313226.1.28352 WP_005313226.1.29842 WP_005313226.1.36887 WP_005313226.1.38021 WP_005313226.1.40195 WP_005313226.1.41377 WP_005313226.1.46813 WP_005313226.1.49611 WP_005313226.1.49680 WP_005313226.1.51049 WP_005313226.1.51485 WP_005313226.1.52154 WP_005313226.1.53881 WP_005313226.1.57660 WP_005313226.1.5833 WP_005313226.1.62078 WP_005313226.1.75420 WP_005313226.1.79205 WP_005313226.1.86551 WP_005313226.1.86591 WP_005313226.1.8755 WP_005313226.1.91946 WP_005313226.1.93610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]