SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005354445.1.99268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005354445.1.99268
Domain Number 1 Region: 549-1038
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-133
Family ALDH-like 0.000000404
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000365
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.12e-62
Family N-terminal domain of bifunctional PutA protein 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005354445.1.99268
Sequence length 1054
Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Aeromonas veronii]; AA=GCF_000820225.1; RF=na; TAX=197701; STAX=654; NAME=Aeromonas veronii bv. veronii; strain=CECT 4257; AL=Scaffold; RT=Major
Sequence
MFKATQVLAADYIPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLEQVTQRARTL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANLLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSRELGYTHTYDMLGESALTMQDADKYLTDYRNAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMCERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSDANRGWGKLGMVVQAYSKRALPVLCWLTALAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFIAPQFATHNANT
VVSILEMVGDRQFEFQRLHGMGEELHNAVLNDNPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYSGFANDRIPQPVNLFTDRKNSSGVNMNI
LSIQRPFFARLKELESKQWLAGPIVDGETLKRSEARTVLSPQDVSLTVGKIHWADEQAVE
QALASAHAAFPRWRETPVSERAAALEKLADLLEANREQFVSLCTREAGKLLQDGIDEVRE
AVDFCRYYAVQARSLMGQATLLPGYTGEQNELFLQGRGVFVCISPWNFPLAIFLGQIAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADPRIGGVC
FTGSTEIAKLINMTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAERVLEILTGAMQELKVGNPAEHNTDVGPVIDADAKAGLDAHLARM
IPRARLIAQAPMPAATMEGHFVQPTALEIGSIRELAKEQFGPILHVVRYATRDLDKVISD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLGRFVTEKTRTINTTAVGGNASLLAMGDA
Download sequence
Identical sequences gi|330828455|ref|YP_004391407.1| WP_005354445.1.12379 WP_005354445.1.36635 WP_005354445.1.64938 WP_005354445.1.99268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]