SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005417224.1.76652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005417224.1.76652
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Translation proteins 3.8e-84
Family Ribosomal protein L3 0.0000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005417224.1.76652
Sequence length 209
Comment 50S ribosomal protein L3 [Aliivibrio fischeri]; AA=GCF_001029395.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=VCW2E2; AL=Scaffold; RT=Major
Sequence
MIGLVGRKVGMTRIFTEEGVSIPVTVVEVEANRVSQVKTVETDGYNAIQVTCGSKKANRV
SKPEAGHFAKAGVEAGRGLWEFRLENGEEFAVGAELTVEVFNEIKKVDVTGTSKGKGFQG
AVKRWNFRTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKKMAGHMGAERVTTQNLEIVRV
DAERNLLLIKGAVPGSTGGNVIVKPAVKA
Download sequence
Identical sequences A0A1B9PAN4 B5FG09
312309.VF_0235 388396.VFMJ11_0225 gi|172087649|ref|YP_203618.2| gi|197333952|ref|YP_002154996.1| WP_005417224.1.100783 WP_005417224.1.102040 WP_005417224.1.11820 WP_005417224.1.198 WP_005417224.1.21686 WP_005417224.1.21775 WP_005417224.1.21836 WP_005417224.1.23113 WP_005417224.1.31530 WP_005417224.1.32349 WP_005417224.1.34024 WP_005417224.1.3463 WP_005417224.1.34959 WP_005417224.1.44395 WP_005417224.1.47877 WP_005417224.1.62330 WP_005417224.1.66091 WP_005417224.1.76599 WP_005417224.1.76652 WP_005417224.1.77059 WP_005417224.1.81434 WP_005417224.1.82276 WP_005417224.1.85856 WP_005417224.1.93430 WP_005417224.1.94618 WP_005417224.1.97281 YP_203618.2.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]