SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005417238.1.21686 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005417238.1.21686
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 4.06e-23
Family Ribosomal protein L29 (L29p) 0.0000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005417238.1.21686
Sequence length 63
Comment MULTISPECIES: 50S ribosomal protein L29 [Aliivibrio]; AA=GCF_000287175.2; RF=na; TAX=617135; STAX=668; NAME=Aliivibrio fischeri ZF-211; strain=ZF-211; AL=Scaffold; RT=Major
Sequence
MKAQDLREKNVEELNEELLNLLREQFNLRMQAATGQLQQTHTLKAVRRDIARVKTLLNEK
AGA
Download sequence
Identical sequences A0A090INJ2 A0A1B9NUS8 A0A1B9PAQ0 B5FG17 B6EPT3 Q5E8A7
312309.VF_0244 316275.VSAL_I0328 388396.VFMJ11_0233 gi|209693932|ref|YP_002261860.1| gi|59710851|ref|YP_203627.1| WP_005417238.1.100783 WP_005417238.1.101673 WP_005417238.1.102040 WP_005417238.1.11820 WP_005417238.1.198 WP_005417238.1.21686 WP_005417238.1.21775 WP_005417238.1.21836 WP_005417238.1.23113 WP_005417238.1.31530 WP_005417238.1.32349 WP_005417238.1.33597 WP_005417238.1.34024 WP_005417238.1.3463 WP_005417238.1.34959 WP_005417238.1.35969 WP_005417238.1.44395 WP_005417238.1.47877 WP_005417238.1.50441 WP_005417238.1.54541 WP_005417238.1.62330 WP_005417238.1.66091 WP_005417238.1.70793 WP_005417238.1.73213 WP_005417238.1.76599 WP_005417238.1.76652 WP_005417238.1.77059 WP_005417238.1.77666 WP_005417238.1.80135 WP_005417238.1.81434 WP_005417238.1.82276 WP_005417238.1.82896 WP_005417238.1.85856 WP_005417238.1.93430 WP_005417238.1.94618 WP_005417238.1.94693 WP_005417238.1.9550 WP_005417238.1.97281 YP_203627.1.56684 gi|197334057|ref|YP_002155004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]