SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005428778.1.83275 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005428778.1.83275
Domain Number 1 Region: 14-467
Classification Level Classification E-value
Superfamily L-aspartase-like 5.89e-144
Family L-aspartase/fumarase 0.00000000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005428778.1.83275
Sequence length 483
Comment MULTISPECIES: aspartate ammonia-lyase [Vibrio]; AA=GCF_000772655.1; RF=na; TAX=680; STAX=680; NAME=Vibrio campbellii; strain=UMTGB204; AL=Contig; RT=Major
Sequence
MATLSDAPKTANQATRIEEDLLGQRHVPADAYYGIHTLRAIENFNISSTTISDVPEFVRG
MVMTKKAAALANKELGAIPKDVANYILEACDLILETGKCMDQFPSDVFQGGAGTSVNMNT
NEVIANVALELMGKEKGQYEFINPNDHVNKSQSTNCAYPTGFRIAVYNSVHQLMEAIEYL
KGAFELKAQEFKDVLKMGRTQLQDAVPMTVGQEFHAWAVTLNEEIRALDYTSKLLLEINL
GATAIGTGLNAPTGYQALAVKHLAEVTGVEVVAAEDLIEATSDCGAYVMTHGALKRLAVK
LSKICNDLRLLSSGPRAGLNELNLPEMQAGSSIMPAKVNPVIPEVVNQVCFKVLGNDNTV
SFAAEGGQLQLNVMEPVIAQSVFESISLLHNACVNLRDKCIDGITVNKEVCENYVYNSIG
IVTYLNPYIGHHEGDIVGKICAETGKSVRDVVLERGLLTAEELDDILSVENFMHPTYKAK
RYE
Download sequence
Identical sequences A0A0A3EII1 A0A1E3E6G0 A0A2G5JFP8 A0A2K7SSW8 A7MXJ4 K5TTZ0
gi|156972522|ref|YP_001443429.1| 338187.VIBHAR_00154 gi|538263909|gb|AGU95110.1| WP_005428778.1.100291 WP_005428778.1.101244 WP_005428778.1.1093 WP_005428778.1.11263 WP_005428778.1.11576 WP_005428778.1.12359 WP_005428778.1.14974 WP_005428778.1.1535 WP_005428778.1.16148 WP_005428778.1.16230 WP_005428778.1.18167 WP_005428778.1.18807 WP_005428778.1.19947 WP_005428778.1.20092 WP_005428778.1.25047 WP_005428778.1.25554 WP_005428778.1.27229 WP_005428778.1.32528 WP_005428778.1.34412 WP_005428778.1.40020 WP_005428778.1.41816 WP_005428778.1.43967 WP_005428778.1.45469 WP_005428778.1.4651 WP_005428778.1.49791 WP_005428778.1.50021 WP_005428778.1.50503 WP_005428778.1.52961 WP_005428778.1.53497 WP_005428778.1.55333 WP_005428778.1.56715 WP_005428778.1.57729 WP_005428778.1.5980 WP_005428778.1.61993 WP_005428778.1.64178 WP_005428778.1.64533 WP_005428778.1.66627 WP_005428778.1.68715 WP_005428778.1.70103 WP_005428778.1.72011 WP_005428778.1.74002 WP_005428778.1.7709 WP_005428778.1.78839 WP_005428778.1.79102 WP_005428778.1.81646 WP_005428778.1.83275 WP_005428778.1.88475 WP_005428778.1.89106 WP_005428778.1.90381 WP_005428778.1.92229 WP_005428778.1.94413 WP_005428778.1.99820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]