SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005576613.1.6326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005576613.1.6326
Domain Number 1 Region: 85-238
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-24
Family DnaQ-like 3'-5' exonuclease 0.037
Further Details:      
 
Weak hits

Sequence:  WP_005576613.1.6326
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0736
Family DNA polymerase beta-like, second domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005576613.1.6326
Sequence length 250
Comment exonuclease [Natronobacterium gregoryi]; AA=GCF_000337655.1; RF=na; TAX=797304; STAX=44930; NAME=Natronobacterium gregoryi SP2; strain=SP2; AL=Contig; RT=Major
Sequence
MRIENSFIPVHGVGETTERRLWENGITHWEEFDGSVVGDTLADRIDAFIDDGWTHLDDGD
VSPFAERLPASSRWRLYENVRQETCFLDIETTGLDASCNDVTTVSLHRGGDTKTFVQGRD
LTANRLSRELEESALLVTFNGQRFDVPFLETCYDLEISVPHVDLLYPCKKLGLDGGLKAI
EQEVGIERDHPDISGRDAVRLWHEYERGDESALETLVEYNRADTKNMQPLLDVVADRLHE
AVFEAARQPE
Download sequence
Identical sequences A0A1I3QA14 L0ALG7
WP_005576613.1.6326 WP_005576613.1.71579 WP_005576613.1.8181 gi|429193382|ref|YP_007179060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]