SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005627653.1.52701 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005627653.1.52701
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.36e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000136
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.22e-26
Family Ribosomal protein L11, C-terminal domain 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005627653.1.52701
Sequence length 142
Comment MULTISPECIES: 50S ribosomal protein L11 [Pasteurellaceae]; AA=GCF_001298185.1; RF=na; TAX=727; STAX=727; NAME=Haemophilus influenzae; strain=HI1413; AL=Contig; RT=Major
Sequence
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLDQVRQIAETKAADMTGA
SIETKMKSIAGTARSMGLVVEE
Download sequence
Identical sequences A0A0D0GYR5 A0A0E1SQ66 A0A0M3G916 A4NV49 A5UH22 E7A717 F2BZ26
gi|319775562|ref|YP_004138050.1| WP_005627653.1.101347 WP_005627653.1.1036 WP_005627653.1.12387 WP_005627653.1.17173 WP_005627653.1.17253 WP_005627653.1.17428 WP_005627653.1.20018 WP_005627653.1.20644 WP_005627653.1.25413 WP_005627653.1.26077 WP_005627653.1.28719 WP_005627653.1.38951 WP_005627653.1.40038 WP_005627653.1.40040 WP_005627653.1.40503 WP_005627653.1.41611 WP_005627653.1.42729 WP_005627653.1.42821 WP_005627653.1.45125 WP_005627653.1.46862 WP_005627653.1.50507 WP_005627653.1.52701 WP_005627653.1.55069 WP_005627653.1.56181 WP_005627653.1.63263 WP_005627653.1.67509 WP_005627653.1.76369 WP_005627653.1.78014 WP_005627653.1.78836 WP_005627653.1.79564 WP_005627653.1.81823 WP_005627653.1.87366 WP_005627653.1.87894 WP_005627653.1.90238 WP_005627653.1.90586 WP_005627653.1.92138 WP_005627653.1.93908 WP_005627653.1.96396 WP_005627653.1.97818 374931.CGSHiGG_05835 gi|148827708|ref|YP_001292461.1| gi|543951398|ref|YP_008543472.1| gi|319897969|ref|YP_004136166.1| gi|386263294|ref|YP_005826787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]