SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005647241.1.20018 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005647241.1.20018
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000000000196
Family H-NS histone-like proteins 0.001
Further Details:      
 
Domain Number 2 Region: 92-134
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000373
Family H-NS histone-like proteins 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005647241.1.20018
Sequence length 134
Comment MULTISPECIES: DNA-binding protein H-NS [Haemophilus]; AA=GCF_000169835.1; RF=na; TAX=374933; STAX=727; NAME=Haemophilus influenzae PittII; strain=PittII; AL=Contig; RT=Major
Sequence
MNELVRGLTNLRSLRAAVRELTLEQAENALEKLQTAIEEKRANEAELIKAETERKERLAK
YKELMEKEGITPEELHEIFGTKTVSIRAKRAPRPAKYAFIDENGEHKTWTGQGRTPRPIQ
NALNKGKSLSDFEI
Download sequence
Identical sequences A0A0D0H1X3 A0A0E1SKS1 A0A0E1WLJ4 A4MV29 A4N4E8 A5UJ37 P43841 Q4QL17
281310.NTHI1464 374931.CGSHiGG_10180 71421.HI1587 gi|68249828|ref|YP_248940.1| gi|386266022|ref|YP_005829514.1| gi|148828423|ref|YP_001293176.1| gi|386264300|ref|YP_005827793.1| NP_439732.1.63031 WP_005647241.1.101347 WP_005647241.1.17173 WP_005647241.1.17428 WP_005647241.1.17459 WP_005647241.1.20018 WP_005647241.1.20073 WP_005647241.1.23920 WP_005647241.1.25413 WP_005647241.1.26077 WP_005647241.1.26667 WP_005647241.1.27712 WP_005647241.1.28397 WP_005647241.1.32414 WP_005647241.1.32618 WP_005647241.1.32982 WP_005647241.1.34722 WP_005647241.1.37003 WP_005647241.1.38951 WP_005647241.1.39279 WP_005647241.1.39974 WP_005647241.1.40038 WP_005647241.1.40040 WP_005647241.1.40343 WP_005647241.1.40503 WP_005647241.1.40942 WP_005647241.1.42240 WP_005647241.1.42729 WP_005647241.1.42821 WP_005647241.1.44893 WP_005647241.1.45125 WP_005647241.1.4569 WP_005647241.1.51509 WP_005647241.1.52701 WP_005647241.1.5387 WP_005647241.1.53947 WP_005647241.1.54653 WP_005647241.1.55069 WP_005647241.1.56005 WP_005647241.1.56181 WP_005647241.1.57183 WP_005647241.1.59352 WP_005647241.1.59529 WP_005647241.1.6054 WP_005647241.1.61635 WP_005647241.1.62697 WP_005647241.1.63263 WP_005647241.1.64134 WP_005647241.1.68713 WP_005647241.1.74240 WP_005647241.1.74810 WP_005647241.1.75514 WP_005647241.1.75525 WP_005647241.1.76348 WP_005647241.1.76369 WP_005647241.1.76410 WP_005647241.1.78014 WP_005647241.1.79255 WP_005647241.1.79564 WP_005647241.1.79785 WP_005647241.1.80605 WP_005647241.1.82381 WP_005647241.1.85244 WP_005647241.1.8638 WP_005647241.1.87366 WP_005647241.1.87894 WP_005647241.1.91647 WP_005647241.1.91769 WP_005647241.1.93723 WP_005647241.1.94547 WP_005647241.1.94621 WP_005647241.1.9694 WP_005647241.1.97721 WP_005647241.1.99326 gi|16273481|ref|NP_439732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]