SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005648963.1.74023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005648963.1.74023
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.58e-38
Family DNA-binding N-terminal domain of transcription activators 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005648963.1.74023
Sequence length 128
Comment MULTISPECIES: heavy metal-dependent transcriptional regulator [Haemophilus]; AA=GCF_001184615.1; RF=na; TAX=727; STAX=727; NAME=Haemophilus influenzae; strain=HI1417; AL=Contig; RT=Major
Sequence
MNISEAAKLVGLSTKQIRDYEKIGLIKPAVRSLSGYRNYGESDLERLHFIRHSRNVGFSL
HQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQKLQHWHDSCQGNDNPEC
LILNGLNG
Download sequence
Identical sequences A0A0E1SWL8 A0A0E1WK42 A0A0H3PF73 A0A0X9ZIX1 A0A0Y7L2B9 A4MXP6 A5UGB1 E1X9T6 E7A897
gi|148827447|ref|YP_001292200.1| gi|319775838|ref|YP_004138326.1| WP_005648963.1.101347 WP_005648963.1.101989 WP_005648963.1.1036 WP_005648963.1.12329 WP_005648963.1.13610 WP_005648963.1.17173 WP_005648963.1.17253 WP_005648963.1.17428 WP_005648963.1.17459 WP_005648963.1.20018 WP_005648963.1.20644 WP_005648963.1.20853 WP_005648963.1.23065 WP_005648963.1.26077 WP_005648963.1.27712 WP_005648963.1.28719 WP_005648963.1.32414 WP_005648963.1.32618 WP_005648963.1.34722 WP_005648963.1.34925 WP_005648963.1.37003 WP_005648963.1.3733 WP_005648963.1.37452 WP_005648963.1.38951 WP_005648963.1.39974 WP_005648963.1.40040 WP_005648963.1.40942 WP_005648963.1.42240 WP_005648963.1.42267 WP_005648963.1.42729 WP_005648963.1.42821 WP_005648963.1.43923 WP_005648963.1.45125 WP_005648963.1.46862 WP_005648963.1.48995 WP_005648963.1.52701 WP_005648963.1.53947 WP_005648963.1.54653 WP_005648963.1.54661 WP_005648963.1.56005 WP_005648963.1.57312 WP_005648963.1.58856 WP_005648963.1.6054 WP_005648963.1.61426 WP_005648963.1.62109 WP_005648963.1.63263 WP_005648963.1.6349 WP_005648963.1.67509 WP_005648963.1.68713 WP_005648963.1.71424 WP_005648963.1.74023 WP_005648963.1.75193 WP_005648963.1.75514 WP_005648963.1.75525 WP_005648963.1.76348 WP_005648963.1.76369 WP_005648963.1.76422 WP_005648963.1.76737 WP_005648963.1.78014 WP_005648963.1.78836 WP_005648963.1.82376 WP_005648963.1.82381 WP_005648963.1.85362 WP_005648963.1.8638 WP_005648963.1.86544 WP_005648963.1.86649 WP_005648963.1.87894 WP_005648963.1.88810 WP_005648963.1.90238 WP_005648963.1.90586 WP_005648963.1.92138 WP_005648963.1.92858 WP_005648963.1.93392 WP_005648963.1.94624 WP_005648963.1.96396 WP_005648963.1.96546 WP_005648963.1.9761 WP_005648963.1.97721 WP_005648963.1.97818 WP_005648963.1.98200 WP_005648963.1.99326 WP_005648963.1.99776 gi|319896626|ref|YP_004134819.1| gi|543952787|ref|YP_008544861.1| gi|386265310|ref|YP_005828802.1| gi|386263513|ref|YP_005827006.1| gi|378696484|ref|YP_005178442.1| 374931.CGSHiGG_04280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]