SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005689143.1.86216 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005689143.1.86216
Domain Number 1 Region: 202-589
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.57e-88
Family beta-Lactamase/D-ala carboxypeptidase 0.000000633
Further Details:      
 
Domain Number 2 Region: 66-249
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.09e-41
Family Penicillin binding protein dimerisation domain 0.0000374
Further Details:      
 
Domain Number 3 Region: 599-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0066
Further Details:      
 
Domain Number 4 Region: 659-702
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005689143.1.86216
Sequence length 714
Comment MULTISPECIES: penicillin-binding protein 2B [Lactobacillus]; AA=GCF_001657155.1; RF=na; TAX=47715; STAX=47715; NAME=Lactobacillus rhamnosus; strain=Lrh12; AL=Contig; RT=Major
Sequence
MKIFKSKRSTNAHPARNRKFFGIGLIGFTLLVLGGFVLRFSFVATIGEVDSNNLAKQRQK
QYQTDTVLQAQRGAILDRSGNVIAEDSNTYTIYAILDKQNKNGDKPDYVTNKAKTAKILS
RYLAIGEDKVLARLNPSKNLFQVEFGRPGTKLSLAIKKQIEAEKLPGIHFRETPSRLYPN
GVFASHVIGLAQAQDNGGGLTGVMGLEKQFNTVLTGTNGYRRSETDAYGYKLPNAKTKAK
APVNGGSVYTTLDSGLQAYLETLMTDVQTKYEPKGMTAVLMNAKTGRILAATQRPTFDAS
TGEGLGDMWRDSLVEDNYEPGSVMKIMTLAAAIQSGKYHPNEYFQSGSVKLDGGTVNDWR
TGGWGSIPLSKAFPLSSNVGMVKIEQEMGAGIWKSYLDKFKFGQKTGITLPGETSGRISF
QRPLDQAITAFGQGIEVNVMQMMQAISAVANDGKMLKPQIVSKVVNKNGKATVYKPEVVG
QPISKETAARVIDAMRHVVNDEDGTGVAYKMPGVDLAVKTGTGQIASAQGGYLTGDSNYT
FSVAGIAPASNPKYVLYVAMKQPQKMTEPAESILASIFKPMMQRALDTTANSTVSGETNT
AEVPAVTNAALASAQDTVKKAGFDVATIGTGNKIVQQLPASGTKALRDSRVLLLTNGAMT
MPDLTGWSKSDVLKFVQLTGKKFKLVGDGFVVRQSIAKGTLLGNASGTIEFKQQ
Download sequence
Identical sequences A0A2G9IU22 C2JWP5
gi|258539489|ref|YP_003173988.1| gi|385835136|ref|YP_005872910.1| WP_005689143.1.14021 WP_005689143.1.16842 WP_005689143.1.18871 WP_005689143.1.24248 WP_005689143.1.25484 WP_005689143.1.32073 WP_005689143.1.36928 WP_005689143.1.37924 WP_005689143.1.41093 WP_005689143.1.43381 WP_005689143.1.44898 WP_005689143.1.45310 WP_005689143.1.53665 WP_005689143.1.56295 WP_005689143.1.57153 WP_005689143.1.59185 WP_005689143.1.60726 WP_005689143.1.70401 WP_005689143.1.70502 WP_005689143.1.70613 WP_005689143.1.71250 WP_005689143.1.72024 WP_005689143.1.76218 WP_005689143.1.8089 WP_005689143.1.81670 WP_005689143.1.84719 WP_005689143.1.86216 WP_005689143.1.87473 WP_005689143.1.87509 WP_005689143.1.9147 WP_005689143.1.94635 WP_005689143.1.97125 WP_005689143.1.98686 WP_005689143.1.99535 gi|523519749|ref|YP_008205829.1| 568704.LC705_01298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]