SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005718573.1.17980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005718573.1.17980
Domain Number 1 Region: 109-296
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.79e-60
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 8-138
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 5.74e-51
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0000067
Further Details:      
 
Domain Number 3 Region: 334-409
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000379
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005718573.1.17980
Sequence length 410
Comment D-3-phosphoglycerate dehydrogenase [Pasteurella multocida]; AA=GCF_001510775.1; RF=na; TAX=747; STAX=747; NAME=Pasteurella multocida; strain=SMC1; AL=Contig; RT=Major
Sequence
MTTKVSLDKSKIKFLLLEGVHQTALEVLQNAGYTNIEYHKKALDDDELKEAIKDAHFVGI
RSRTFLTEEVLAHAQKLIAIGCFCIGTNQVNLQAAKLRGIPVFNAPFSNTRSVAELVLGE
ILLLMRNVPQANAEVHRGIWNKSANGSHEVRGKKLGIIGYGHIGSQLSIIAESLGMRVFF
YDIENKLPLGNAQQLRTLEELLSSCDVVSLHVPENASTKNLISAERIAQLKEGAILINAA
RGTVVDIDALAQALEAGKIRGAALDVFPEEPASIQEEFVSPLRAFDNVILTPHIGGSTSE
AQENIGAEVSGKFVKYSDNGSTLSAVNFPEVSLPEHVGTKRLLHIHHNKQGVLNKINQVF
VDANVNIAAQYLQTDPAIGYVVIDVETEDTHSLLTQLKEIEGTIRARVLY
Download sequence
Identical sequences A0A1D7R4C2 A0A2K2YM85 Q9CKF1 V4PZB7
WP_005718573.1.10027 WP_005718573.1.10721 WP_005718573.1.11014 WP_005718573.1.11214 WP_005718573.1.11947 WP_005718573.1.12156 WP_005718573.1.12311 WP_005718573.1.1307 WP_005718573.1.14908 WP_005718573.1.15732 WP_005718573.1.17217 WP_005718573.1.17980 WP_005718573.1.18123 WP_005718573.1.19996 WP_005718573.1.20287 WP_005718573.1.21657 WP_005718573.1.22153 WP_005718573.1.2313 WP_005718573.1.23830 WP_005718573.1.24757 WP_005718573.1.26616 WP_005718573.1.26777 WP_005718573.1.27416 WP_005718573.1.27664 WP_005718573.1.28084 WP_005718573.1.29697 WP_005718573.1.30617 WP_005718573.1.34253 WP_005718573.1.35562 WP_005718573.1.35978 WP_005718573.1.36022 WP_005718573.1.3807 WP_005718573.1.38246 WP_005718573.1.3839 WP_005718573.1.39152 WP_005718573.1.3957 WP_005718573.1.40210 WP_005718573.1.40787 WP_005718573.1.41351 WP_005718573.1.41462 WP_005718573.1.41667 WP_005718573.1.42469 WP_005718573.1.42943 WP_005718573.1.43687 WP_005718573.1.44741 WP_005718573.1.45422 WP_005718573.1.47685 WP_005718573.1.4808 WP_005718573.1.49053 WP_005718573.1.50853 WP_005718573.1.51342 WP_005718573.1.52066 WP_005718573.1.52585 WP_005718573.1.52859 WP_005718573.1.53852 WP_005718573.1.55401 WP_005718573.1.57420 WP_005718573.1.58111 WP_005718573.1.58257 WP_005718573.1.58450 WP_005718573.1.58628 WP_005718573.1.58910 WP_005718573.1.59455 WP_005718573.1.60478 WP_005718573.1.60664 WP_005718573.1.61098 WP_005718573.1.61860 WP_005718573.1.62016 WP_005718573.1.6219 WP_005718573.1.62389 WP_005718573.1.6332 WP_005718573.1.63549 WP_005718573.1.65482 WP_005718573.1.65878 WP_005718573.1.66934 WP_005718573.1.66990 WP_005718573.1.70689 WP_005718573.1.72215 WP_005718573.1.73917 WP_005718573.1.74955 WP_005718573.1.75804 WP_005718573.1.78987 WP_005718573.1.79347 WP_005718573.1.79593 WP_005718573.1.80223 WP_005718573.1.80589 WP_005718573.1.80911 WP_005718573.1.81885 WP_005718573.1.8281 WP_005718573.1.83579 WP_005718573.1.86541 WP_005718573.1.87897 WP_005718573.1.88402 WP_005718573.1.89773 WP_005718573.1.90081 WP_005718573.1.90179 WP_005718573.1.90578 WP_005718573.1.91495 WP_005718573.1.92478 WP_005718573.1.93940 WP_005718573.1.94435 WP_005718573.1.95718 WP_005718573.1.9746 WP_005718573.1.9947 gi|378775678|ref|YP_005177921.1| 272843.PM1671 gi|15603536|ref|NP_246610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]