SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005719422.1.2313 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005719422.1.2313
Domain Number 1 Region: 52-317
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.11e-71
Family Biotin synthase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005719422.1.2313
Sequence length 320
Comment lipoyl synthase [Pasteurella multocida]; AA=GCF_001930895.1; RF=na; TAX=747; STAX=747; NAME=Pasteurella multocida; strain=3347PM; AL=Scaffold; RT=Major
Sequence
MGTPFKMERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLPANSAKIDSIKNGMRR
HGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAHGKPLPPDPEEPRKLAE
TIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRQLNPNIKIEILVPDFRGRIEQALD
KLKDNPPDVFNHNLENVPRLYREIRPGADYQWSLKLLKDFKAMFPHIPTKSGLMVGLGET
NEEILQVMQDLRDHGVTMLTLGQYLQPSRHHLPVARYVPPAEFDEFRDKAQAMGFEHAAC
GPFVRSSYHADLQAKGEIVK
Download sequence
Identical sequences A0A1D7R6D5 P57978 V4NAL7
272843.PM1930 gi|15603795|ref|NP_246869.1| gi|383311032|ref|YP_005363842.1| WP_005719422.1.10027 WP_005719422.1.10721 WP_005719422.1.11014 WP_005719422.1.11214 WP_005719422.1.11947 WP_005719422.1.12156 WP_005719422.1.12311 WP_005719422.1.1307 WP_005719422.1.15732 WP_005719422.1.17217 WP_005719422.1.18123 WP_005719422.1.19996 WP_005719422.1.20287 WP_005719422.1.21657 WP_005719422.1.22153 WP_005719422.1.2313 WP_005719422.1.23830 WP_005719422.1.26616 WP_005719422.1.26777 WP_005719422.1.27416 WP_005719422.1.27592 WP_005719422.1.28084 WP_005719422.1.29697 WP_005719422.1.30617 WP_005719422.1.34253 WP_005719422.1.35562 WP_005719422.1.35978 WP_005719422.1.36022 WP_005719422.1.3807 WP_005719422.1.38246 WP_005719422.1.3839 WP_005719422.1.39152 WP_005719422.1.40210 WP_005719422.1.41297 WP_005719422.1.41462 WP_005719422.1.41657 WP_005719422.1.42469 WP_005719422.1.42512 WP_005719422.1.42943 WP_005719422.1.43687 WP_005719422.1.44741 WP_005719422.1.45422 WP_005719422.1.47685 WP_005719422.1.4808 WP_005719422.1.49053 WP_005719422.1.50853 WP_005719422.1.51342 WP_005719422.1.52066 WP_005719422.1.52585 WP_005719422.1.52859 WP_005719422.1.53852 WP_005719422.1.55074 WP_005719422.1.55401 WP_005719422.1.57420 WP_005719422.1.57956 WP_005719422.1.58257 WP_005719422.1.58450 WP_005719422.1.58628 WP_005719422.1.58910 WP_005719422.1.59455 WP_005719422.1.60478 WP_005719422.1.60664 WP_005719422.1.61860 WP_005719422.1.62016 WP_005719422.1.6219 WP_005719422.1.62389 WP_005719422.1.6332 WP_005719422.1.63549 WP_005719422.1.65482 WP_005719422.1.65878 WP_005719422.1.66934 WP_005719422.1.66990 WP_005719422.1.72215 WP_005719422.1.73917 WP_005719422.1.74955 WP_005719422.1.75804 WP_005719422.1.78987 WP_005719422.1.79347 WP_005719422.1.80223 WP_005719422.1.80589 WP_005719422.1.80911 WP_005719422.1.81885 WP_005719422.1.8281 WP_005719422.1.83579 WP_005719422.1.86541 WP_005719422.1.87897 WP_005719422.1.89773 WP_005719422.1.90081 WP_005719422.1.90179 WP_005719422.1.90578 WP_005719422.1.91495 WP_005719422.1.94432 WP_005719422.1.94435 WP_005719422.1.95718 WP_005719422.1.9746 WP_005719422.1.9947 gi|378775010|ref|YP_005177253.1| gi|386835023|ref|YP_006240340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]