SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005721143.1.66934 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005721143.1.66934
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.28e-17
Family Extradiol dioxygenases 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005721143.1.66934
Sequence length 126
Comment hypothetical protein [Pasteurella multocida]; AA=GCF_001930065.1; RF=na; TAX=747; STAX=747; NAME=Pasteurella multocida; strain=2267PM; AL=Scaffold; RT=Major
Sequence
MSNPVSWFEIHVENLQRAKTFYQAVFQLPLTDGDCPSGEKMSVCFFSTDYAQYGIGGMLY
EDKDFPVVRGNNFTLFFACEDCTVEAERAVKFGGKLLQGKTSIGDEGFYAVIEDSEGNRI
GLHSMQ
Download sequence
Identical sequences A0A1D7R2E7 Q9CNZ1 V4N7G1
gi|378774646|ref|YP_005176889.1| 272843.PM0279 WP_005721143.1.10027 WP_005721143.1.10721 WP_005721143.1.11014 WP_005721143.1.11214 WP_005721143.1.11947 WP_005721143.1.12156 WP_005721143.1.12311 WP_005721143.1.1307 WP_005721143.1.14908 WP_005721143.1.15732 WP_005721143.1.17217 WP_005721143.1.17980 WP_005721143.1.18123 WP_005721143.1.19996 WP_005721143.1.20287 WP_005721143.1.21657 WP_005721143.1.22153 WP_005721143.1.2313 WP_005721143.1.23830 WP_005721143.1.24757 WP_005721143.1.26616 WP_005721143.1.27416 WP_005721143.1.28084 WP_005721143.1.29697 WP_005721143.1.30617 WP_005721143.1.34253 WP_005721143.1.35562 WP_005721143.1.35978 WP_005721143.1.36022 WP_005721143.1.3807 WP_005721143.1.38246 WP_005721143.1.3839 WP_005721143.1.39152 WP_005721143.1.3957 WP_005721143.1.40210 WP_005721143.1.40787 WP_005721143.1.41297 WP_005721143.1.41351 WP_005721143.1.41462 WP_005721143.1.41667 WP_005721143.1.4211 WP_005721143.1.42469 WP_005721143.1.42943 WP_005721143.1.43687 WP_005721143.1.44741 WP_005721143.1.45422 WP_005721143.1.47685 WP_005721143.1.4808 WP_005721143.1.49053 WP_005721143.1.50853 WP_005721143.1.51342 WP_005721143.1.52066 WP_005721143.1.52585 WP_005721143.1.52859 WP_005721143.1.53852 WP_005721143.1.55074 WP_005721143.1.55401 WP_005721143.1.57420 WP_005721143.1.57956 WP_005721143.1.58111 WP_005721143.1.58257 WP_005721143.1.58450 WP_005721143.1.58628 WP_005721143.1.58910 WP_005721143.1.59455 WP_005721143.1.60478 WP_005721143.1.60664 WP_005721143.1.61098 WP_005721143.1.61860 WP_005721143.1.62016 WP_005721143.1.6219 WP_005721143.1.62389 WP_005721143.1.6332 WP_005721143.1.63549 WP_005721143.1.65482 WP_005721143.1.65878 WP_005721143.1.66934 WP_005721143.1.66990 WP_005721143.1.70689 WP_005721143.1.72215 WP_005721143.1.73917 WP_005721143.1.74955 WP_005721143.1.75804 WP_005721143.1.78987 WP_005721143.1.79347 WP_005721143.1.79593 WP_005721143.1.80223 WP_005721143.1.80589 WP_005721143.1.80911 WP_005721143.1.81885 WP_005721143.1.8281 WP_005721143.1.83579 WP_005721143.1.86541 WP_005721143.1.87897 WP_005721143.1.88402 WP_005721143.1.89773 WP_005721143.1.90081 WP_005721143.1.90179 WP_005721143.1.90578 WP_005721143.1.91495 WP_005721143.1.92478 WP_005721143.1.93940 WP_005721143.1.94435 WP_005721143.1.95718 WP_005721143.1.9746 gi|383310616|ref|YP_005363426.1| gi|15602144|ref|NP_245216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]