SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005722174.1.42469 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005722174.1.42469
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Peptide methionine sulfoxide reductase 4.84e-75
Family Peptide methionine sulfoxide reductase 0.00000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005722174.1.42469
Sequence length 174
Comment peptide-methionine (S)-S-oxide reductase [Pasteurella multocida]; AA=GCF_001670775.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=ATCC 15742; AL=Scaffold; RT=Major
Sequence
MTQQAIFAGGCFWCVEAVFNQIKGVEKATSGYINGTTENPTYKEVCTGETGHAEAVKVEF
DATVISYEKLLDIFFSIHNPTQLNHQGEDVGTQYRTGIYYLNDEQEQLANKKIAELQPHF
AEKIVTEVLPAQTFYPAEDYHQGYLLQNPQNSYCNLVATPKFLKAKVKFEEIWK
Download sequence
Identical sequences Q9CN40
WP_005722174.1.11014 WP_005722174.1.12311 WP_005722174.1.15732 WP_005722174.1.19996 WP_005722174.1.40210 WP_005722174.1.42469 WP_005722174.1.45422 WP_005722174.1.4808 WP_005722174.1.53852 WP_005722174.1.6219 WP_005722174.1.62389 WP_005722174.1.66990 WP_005722174.1.81885 WP_005722174.1.8281 WP_005722174.1.89773 WP_005722174.1.90578 WP_005722174.1.9746 WP_005722174.1.9947 gi|15602470|ref|NP_245542.1| 272843.PM0605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]