SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005722892.1.60478 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005722892.1.60478
Domain Number 1 Region: 26-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.78e-69
Family Phosphate binding protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005722892.1.60478
Sequence length 344
Comment hypothetical protein [Pasteurella multocida]; AA=GCF_000296345.2; RF=na; TAX=1161102; STAX=747; NAME=Pasteurella multocida subsp. multocida VTCCBAA264; strain=VTCCBAA264; AL=Contig; RT=Major
Sequence
MKTLKISAISTALLLSGGLLSSLAFAEGRLTVYCSAQNTMCEQEVEAFGKKYDVKVSHIR
AGTGSILARIEAEKANPQGDVWYGGTLDPHSQAGEMGLLSAYQSPNLQYIPDELKDPAKV
KGNYTSAIYLGVLGFGVNTERLAKLNIPVPKCWQDLTDPRLKNEIQAADPQSSGTAYTAL
ATFIQLWGEDKAFRYLTDLHKNVSQYTKSGNTATRNTARGEAAIGIGFLHEHSIEKEKGA
PVELIVPCEGTGYEIGGVSIIKGARNLDNAKLFVDWALSKEAQELSWQKGETHQILTNTQ
AKQSPYSLDFKSINLINYDFDKYGAVEERKRLIKKWVDEVKLAK
Download sequence
Identical sequences A0A1E3XKR9 A0A2K2Z125 Q9CM82 V4MPT6
gi|386833876|ref|YP_006239190.1| 272843.PM0955 WP_005722892.1.10027 WP_005722892.1.10721 WP_005722892.1.11014 WP_005722892.1.11214 WP_005722892.1.11947 WP_005722892.1.12156 WP_005722892.1.12311 WP_005722892.1.1307 WP_005722892.1.14908 WP_005722892.1.15732 WP_005722892.1.17217 WP_005722892.1.17980 WP_005722892.1.18123 WP_005722892.1.19996 WP_005722892.1.20287 WP_005722892.1.22153 WP_005722892.1.2313 WP_005722892.1.23830 WP_005722892.1.24757 WP_005722892.1.26616 WP_005722892.1.26777 WP_005722892.1.27416 WP_005722892.1.27592 WP_005722892.1.27664 WP_005722892.1.28084 WP_005722892.1.29697 WP_005722892.1.30617 WP_005722892.1.34253 WP_005722892.1.35562 WP_005722892.1.35978 WP_005722892.1.36022 WP_005722892.1.3807 WP_005722892.1.38246 WP_005722892.1.3839 WP_005722892.1.39152 WP_005722892.1.3957 WP_005722892.1.40210 WP_005722892.1.40787 WP_005722892.1.41297 WP_005722892.1.41462 WP_005722892.1.41657 WP_005722892.1.42469 WP_005722892.1.42512 WP_005722892.1.42943 WP_005722892.1.43687 WP_005722892.1.44741 WP_005722892.1.45422 WP_005722892.1.47685 WP_005722892.1.4808 WP_005722892.1.49053 WP_005722892.1.50853 WP_005722892.1.52066 WP_005722892.1.52585 WP_005722892.1.52859 WP_005722892.1.53852 WP_005722892.1.55074 WP_005722892.1.55401 WP_005722892.1.57420 WP_005722892.1.57956 WP_005722892.1.58111 WP_005722892.1.58257 WP_005722892.1.58450 WP_005722892.1.58628 WP_005722892.1.58910 WP_005722892.1.59455 WP_005722892.1.60478 WP_005722892.1.60664 WP_005722892.1.61098 WP_005722892.1.61860 WP_005722892.1.62016 WP_005722892.1.6219 WP_005722892.1.62389 WP_005722892.1.6332 WP_005722892.1.63549 WP_005722892.1.65482 WP_005722892.1.65878 WP_005722892.1.66934 WP_005722892.1.66990 WP_005722892.1.70689 WP_005722892.1.72215 WP_005722892.1.73917 WP_005722892.1.74955 WP_005722892.1.75804 WP_005722892.1.78987 WP_005722892.1.79347 WP_005722892.1.79593 WP_005722892.1.80223 WP_005722892.1.80589 WP_005722892.1.80911 WP_005722892.1.81885 WP_005722892.1.8281 WP_005722892.1.83579 WP_005722892.1.86541 WP_005722892.1.87897 WP_005722892.1.89773 WP_005722892.1.90081 WP_005722892.1.90179 WP_005722892.1.90578 WP_005722892.1.91495 WP_005722892.1.92478 WP_005722892.1.93940 WP_005722892.1.94432 WP_005722892.1.94435 WP_005722892.1.95718 WP_005722892.1.9746 WP_005722892.1.9947 gi|383309895|ref|YP_005362705.1| gi|378773891|ref|YP_005176134.1| gi|15602820|ref|NP_245892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]