SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005724447.1.80911 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005724447.1.80911
Domain Number 1 Region: 202-449
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.21e-77
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000013
Further Details:      
 
Domain Number 2 Region: 7-196
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 9.92e-72
Family Aminoacid dehydrogenases 0.000000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005724447.1.80911
Sequence length 449
Comment glutamate dehydrogenase [Pasteurella multocida]; AA=GCF_001930385.1; RF=na; TAX=747; STAX=747; NAME=Pasteurella multocida; strain=2428PM; AL=Scaffold; RT=Major
Sequence
MSQVATLDAFLERVAQRDGTQPEFLQAVREVFTSIWPFLEANPKYRSQALLERLVEPERV
IQFRVAWTDDQGQTQVNRAFRVQYNSAIGPFKGGMRFHPSVNLSILKFLGFEQIFKNALT
TLPMGGGKGGSDFDPKGKSDGEVMRFCQALMAELYRHVGADTDVPAGDIGVGGREVGYLA
GYMKKLSNQAACVFTGRGLSFGGSLIRPEATGYGLVYFAQAMLAEKGQSFAGKTVSVSGS
GNVAQYAIEKALQLGAKVVTCSDSSGYVYDEAGFTTEKLAALMELKNEKRGRVEEYAKQF
GLKYVAGKTPWEVKVDIALPCATQNELDLASANTLIANGVQLVAEGANMPTTIEATDAFL
DAGVLFGPGKAANAGGVATSGLEMTQSSQRLYWSAEEVDKKLHSIMLDIHANCKKYGTIE
GQANINYVVGANVAGFVKVADAMLAQGVY
Download sequence
Identical sequences A0A1D7R0J4 Q9CPJ4 V4NAW1
gi|386834911|ref|YP_006240228.1| 272843.PM0043 gi|383310864|ref|YP_005363674.1| gi|378774894|ref|YP_005177137.1| WP_005724447.1.10027 WP_005724447.1.10721 WP_005724447.1.11014 WP_005724447.1.11214 WP_005724447.1.11947 WP_005724447.1.12156 WP_005724447.1.12311 WP_005724447.1.1307 WP_005724447.1.14908 WP_005724447.1.15732 WP_005724447.1.17217 WP_005724447.1.17980 WP_005724447.1.18123 WP_005724447.1.19996 WP_005724447.1.20287 WP_005724447.1.22153 WP_005724447.1.2313 WP_005724447.1.23830 WP_005724447.1.24757 WP_005724447.1.26616 WP_005724447.1.26777 WP_005724447.1.27416 WP_005724447.1.27592 WP_005724447.1.28084 WP_005724447.1.29697 WP_005724447.1.30617 WP_005724447.1.34253 WP_005724447.1.35562 WP_005724447.1.35978 WP_005724447.1.36022 WP_005724447.1.3807 WP_005724447.1.38246 WP_005724447.1.3839 WP_005724447.1.39152 WP_005724447.1.3957 WP_005724447.1.40210 WP_005724447.1.40787 WP_005724447.1.41297 WP_005724447.1.41462 WP_005724447.1.41657 WP_005724447.1.42469 WP_005724447.1.42512 WP_005724447.1.42943 WP_005724447.1.43687 WP_005724447.1.44741 WP_005724447.1.45422 WP_005724447.1.47685 WP_005724447.1.4808 WP_005724447.1.49053 WP_005724447.1.50853 WP_005724447.1.52066 WP_005724447.1.52585 WP_005724447.1.52859 WP_005724447.1.53852 WP_005724447.1.55401 WP_005724447.1.57420 WP_005724447.1.57956 WP_005724447.1.58257 WP_005724447.1.58450 WP_005724447.1.58628 WP_005724447.1.58910 WP_005724447.1.59455 WP_005724447.1.60478 WP_005724447.1.60664 WP_005724447.1.61098 WP_005724447.1.61860 WP_005724447.1.62016 WP_005724447.1.6219 WP_005724447.1.62389 WP_005724447.1.6332 WP_005724447.1.63549 WP_005724447.1.65482 WP_005724447.1.65878 WP_005724447.1.66934 WP_005724447.1.66990 WP_005724447.1.70689 WP_005724447.1.72215 WP_005724447.1.73917 WP_005724447.1.74955 WP_005724447.1.75804 WP_005724447.1.78987 WP_005724447.1.79347 WP_005724447.1.79593 WP_005724447.1.80223 WP_005724447.1.80589 WP_005724447.1.80911 WP_005724447.1.8281 WP_005724447.1.83579 WP_005724447.1.86541 WP_005724447.1.87897 WP_005724447.1.89773 WP_005724447.1.90081 WP_005724447.1.90179 WP_005724447.1.90578 WP_005724447.1.91495 WP_005724447.1.94432 WP_005724447.1.94435 WP_005724447.1.95718 WP_005724447.1.9746 WP_005724447.1.9947 gi|15601908|ref|NP_244980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]