SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005725049.1.3957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005725049.1.3957
Domain Number 1 Region: 4-194
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 8.44e-62
Family LeuD-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005725049.1.3957
Sequence length 201
Comment 3-isopropylmalate dehydratase small subunit [Pasteurella multocida]; AA=GCF_001670435.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=ATCC 11039; AL=Scaffold; RT=Major
Sequence
MPKEFKQHTGIAVPLDASNVDTDAIIPKQFLQKVTRIGFGQHLFHEWRFLDDEGKQPNPD
FVLNYPRYQGASILLARENFGCGSSREHAPWALDDYGIRVIIAPSFADIFYGNSLNNQML
PIRLSDEEVEELFQFVNANEGATITVDLETQRVSANNKVYSFEIDPFRRHCLLNGLDNIG
LTLQHEAKIAEYESNIPAFLR
Download sequence
Identical sequences A0A1D2NUX2 A0A2K2YYK2 J5KE93 Q9CJN8
272843.PM1959 gi|15603824|ref|NP_246898.1| WP_005725049.1.11014 WP_005725049.1.11214 WP_005725049.1.11947 WP_005725049.1.12156 WP_005725049.1.12311 WP_005725049.1.14908 WP_005725049.1.15732 WP_005725049.1.17980 WP_005725049.1.19996 WP_005725049.1.21657 WP_005725049.1.24757 WP_005725049.1.26777 WP_005725049.1.27664 WP_005725049.1.28084 WP_005725049.1.35562 WP_005725049.1.36022 WP_005725049.1.3807 WP_005725049.1.38246 WP_005725049.1.3839 WP_005725049.1.3957 WP_005725049.1.40210 WP_005725049.1.40787 WP_005725049.1.42469 WP_005725049.1.43687 WP_005725049.1.45422 WP_005725049.1.4808 WP_005725049.1.49053 WP_005725049.1.51342 WP_005725049.1.52585 WP_005725049.1.53852 WP_005725049.1.55074 WP_005725049.1.55401 WP_005725049.1.58257 WP_005725049.1.60478 WP_005725049.1.61098 WP_005725049.1.6219 WP_005725049.1.62389 WP_005725049.1.6332 WP_005725049.1.63549 WP_005725049.1.66990 WP_005725049.1.70689 WP_005725049.1.72215 WP_005725049.1.78987 WP_005725049.1.79347 WP_005725049.1.79593 WP_005725049.1.81885 WP_005725049.1.8281 WP_005725049.1.83579 WP_005725049.1.89773 WP_005725049.1.90578 WP_005725049.1.95718 WP_005725049.1.9746 WP_005725049.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]