SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005726160.1.24757 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005726160.1.24757
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.92e-49
Family Phosphoglucomutase, first 3 domains 0.00052
Further Details:      
 
Domain Number 2 Region: 258-364
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.61e-31
Family Phosphoglucomutase, first 3 domains 0.0035
Further Details:      
 
Domain Number 3 Region: 155-256
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.53e-29
Family Phosphoglucomutase, first 3 domains 0.00071
Further Details:      
 
Domain Number 4 Region: 358-443
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.27e-22
Family Phosphoglucomutase, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005726160.1.24757
Sequence length 444
Comment phosphoglucosamine mutase [Pasteurella multocida]; AA=GCF_001670545.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=ATCC 1702; AL=Scaffold; RT=Major
Sequence
MAERKYFGTDGVRGKVGTFPITPDFALKLGWAAGKVLATQGSRTVLIGKDTRISGYMLES
ALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTK
LPDDVEEAIEAMLDEPMDCVESAELGRASRINDAVGRYIEFCKGTFPAHLSLENYKIVVD
CAHGATYHIAPNVMRELGAEVIEIGAKPNGLNINEKCGATDIKALQEKVLEVKADVGLAY
DGDGDRLIMVDHLGNKVDGDQVLFIIAREALRAGHLKGGVVGTLMSNMSLELALKQLGIP
FVRANVGDRYVLEKMQEKGWLLGGENSGHIIILDKNTTGDGIIASLAVLSAMVQHNLSLN
ELASAVPLFPQVLINVRFAGGDNPLESAAVKAVAAEVEKRLAGKGRILLRKSGTEPLIRV
MVECEDGALAQQCAEQIADVVRAN
Download sequence
Identical sequences A0A2J9QP31 Q9CNJ0
272843.PM0440 WP_005726160.1.11014 WP_005726160.1.14908 WP_005726160.1.17980 WP_005726160.1.24757 WP_005726160.1.36022 WP_005726160.1.3957 WP_005726160.1.40787 WP_005726160.1.41351 WP_005726160.1.41667 WP_005726160.1.4211 WP_005726160.1.42469 WP_005726160.1.55074 WP_005726160.1.58111 WP_005726160.1.61098 WP_005726160.1.66990 WP_005726160.1.70689 WP_005726160.1.79593 WP_005726160.1.88402 WP_005726160.1.90578 WP_005726160.1.92478 WP_005726160.1.93940 WP_005726160.1.95718 gi|15602305|ref|NP_245377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]