SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005726689.1.9947 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005726689.1.9947
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily CheY-like 1.85e-30
Family CheY-related 0.00093
Further Details:      
 
Domain Number 2 Region: 123-190
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.45e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005726689.1.9947
Sequence length 192
Comment DNA-binding response regulator [Pasteurella multocida]; AA=GCF_000412105.1; RF=na; TAX=1298928; STAX=747; NAME=Pasteurella multocida RIIF; strain=RIIF; AL=Contig; RT=Major
Sequence
MLIHLVDDDLTVLDAARFLLEQAGYQVQTWSNSQAFVNKAPLFEPGVVLLDMKMPLLDGH
QVHQFLCQQQSTLAVVIMTAHADVPMAVQELKQGAVDFLQKPVQFSQLQSVLKTAIQTTQ
SRYERYKIRHCYAQLSRKELDILALLIQGCINRQIAEALNISVRTVEVHRSHIMEKMQAQ
TIAELIYKTAQL
Download sequence
Identical sequences A0A126QEM3 A0A2K2Z0G5 Q9CMT3
gi|383310397|ref|YP_005363207.1| 272843.PM0725 gi|15602590|ref|NP_245662.1| WP_005726689.1.12311 WP_005726689.1.14908 WP_005726689.1.15732 WP_005726689.1.17980 WP_005726689.1.19996 WP_005726689.1.21657 WP_005726689.1.26777 WP_005726689.1.27592 WP_005726689.1.27664 WP_005726689.1.36022 WP_005726689.1.3957 WP_005726689.1.40210 WP_005726689.1.41297 WP_005726689.1.41351 WP_005726689.1.41657 WP_005726689.1.41667 WP_005726689.1.45422 WP_005726689.1.4808 WP_005726689.1.51342 WP_005726689.1.53852 WP_005726689.1.55074 WP_005726689.1.57956 WP_005726689.1.58111 WP_005726689.1.61098 WP_005726689.1.6219 WP_005726689.1.62389 WP_005726689.1.66990 WP_005726689.1.70689 WP_005726689.1.81885 WP_005726689.1.8281 WP_005726689.1.88402 WP_005726689.1.89773 WP_005726689.1.92478 WP_005726689.1.93940 WP_005726689.1.94432 WP_005726689.1.95718 WP_005726689.1.9746 WP_005726689.1.9947 gi|386834131|ref|YP_006239446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]