SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005726731.1.26777 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005726731.1.26777
Domain Number 1 Region: 36-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.98e-57
Family Prokaryotic proteases 0.000000323
Further Details:      
 
Domain Number 2 Region: 230-334
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-17
Family HtrA-like serine proteases 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005726731.1.26777
Sequence length 342
Comment outer membrane-stress sensor serine endopeptidase DegS [Pasteurella multocida]; AA=GCF_900115485.1; RF=na; TAX=747; STAX=747; NAME=Pasteurella multocida; strain=ATCC 51689; AL=Scaffold; RT=Major
Sequence
MIKKLFHSVMIGLVCAAVILVFSHVNQFSLLKAPEPMSFKDAVRVASPAVVNVYNRSFSA
NSAEQLEVGNLGSGVIMSKDGYILTNKHVIQNADQIVVALQNGQLFDASLIGSDTLTDLA
VLKIRADNLSTIPQNPQRQMHVGDVALAIGNPYNLGQSVSQGIISAIGRNAVGDSVGRQN
FIQTDASINRGNSGGALINSVGELIGINTLSIGKTAGEIAEGLNFAIPIELANDVMKKII
RDGRVIRGYFGVQSDILFNNGQGAHLEKGILITNVNPEGPAGKAGVKAGDIILKVGDVDA
ISPAQMMQVISNTRPNTRLNVVISRLGKIIELPVIIEEYPLN
Download sequence
Identical sequences A0A126QGS1 A0A2K2Z192 Q9CMR4
WP_005726731.1.19996 WP_005726731.1.26777 WP_005726731.1.27592 WP_005726731.1.27664 WP_005726731.1.41297 WP_005726731.1.41351 WP_005726731.1.41657 WP_005726731.1.41667 WP_005726731.1.42512 WP_005726731.1.55074 WP_005726731.1.57956 WP_005726731.1.58111 WP_005726731.1.66990 WP_005726731.1.70689 WP_005726731.1.79593 WP_005726731.1.88402 WP_005726731.1.92478 WP_005726731.1.93940 WP_005726731.1.94432 WP_005726731.1.9947 gi|383310422|ref|YP_005363232.1| 272843.PM0748 gi|15602613|ref|NP_245685.1| gi|386834106|ref|YP_006239421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]