SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005751288.1.58257 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005751288.1.58257
Domain Number 1 Region: 26-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-53
Family Phosphate binding protein-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005751288.1.58257
Sequence length 334
Comment thiamine ABC transporter substrate binding subunit [Pasteurella multocida]; AA=GCF_001027755.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=THA; AL=Contig; RT=Major
Sequence
MSRLKTSFFFTALSTLSLSVFAQTQAVNVYTYDSFTSEWGAGPKVKKAFETHFPQCQVNF
TAFGDSGTMFNRLRLEGKKTKADVVVGLDNYNLEEAEKSGLFVQHKVDLTPLSLPVEWKN
QTFLPYDFGQFAFIYDKTKVQQPPKSLKELVERDDLKVIYQDPRTSSVGRGLLIWMNHVY
TENEVAQAWQKLAKHTVTVGKGWSDTYGAFLKGEADVVLSYNTSPLYHMVFEQKDQYLAT
EFEEGGVLQIETAARVAQHDNHCADHFLAFLIHPEAQGHLVKNNVMLPVINTNIEPHFDA
LKATQMNTKVLDTSKVNAEQVKKWIAVWQTTLTQ
Download sequence
Identical sequences A0A1D2NNG4 Q9CNQ1
272843.PM0376 gi|15602241|ref|NP_245313.1| gi|383310011|ref|YP_005362821.1| WP_005751288.1.11214 WP_005751288.1.11947 WP_005751288.1.12156 WP_005751288.1.17980 WP_005751288.1.19996 WP_005751288.1.27592 WP_005751288.1.28084 WP_005751288.1.35562 WP_005751288.1.36022 WP_005751288.1.3807 WP_005751288.1.38246 WP_005751288.1.3839 WP_005751288.1.41297 WP_005751288.1.42512 WP_005751288.1.43687 WP_005751288.1.49053 WP_005751288.1.52585 WP_005751288.1.52859 WP_005751288.1.55401 WP_005751288.1.57956 WP_005751288.1.58257 WP_005751288.1.60478 WP_005751288.1.6332 WP_005751288.1.63549 WP_005751288.1.66990 WP_005751288.1.72215 WP_005751288.1.78987 WP_005751288.1.79347 WP_005751288.1.79593 WP_005751288.1.83579 WP_005751288.1.95718 WP_005751288.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]