SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005752107.1.72215 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005752107.1.72215
Domain Number 1 Region: 179-474
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.51e-124
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.00000000731
Further Details:      
 
Domain Number 2 Region: 6-175
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.21e-57
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005752107.1.72215
Sequence length 484
Comment phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [Pasteurella multocida]; AA=GCF_001027695.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=TX1; AL=Contig; RT=Major
Sequence
MSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAFNRTTSKVDEFLQGAAKGTNIIGAYSLE
DLANKLEKPRKVMLMVRAGEVVDQFIEALLPHLEEGDIIIDGGNTNYPDTNRRVAYLREK
GIRFIGTGVSGGEEGARFGPSIMPGGDESAWEHVKPILQAISAKTDKGEACCDWVGRDGA
GHFVKMVHNGIEYGDMQLICEAYQFLKEGVGLSDDELEATFKAWRNTELDSYLIDITADI
LGYKDEDGSRLVDKILDTAGQKGTGKWTGINALDFGIPLTLITESVFARCVSSFKEQRVQ
ASRLFNKVVGKVEGDKAAWVEAVRKALLASKIISYAQGFMLIREASENFGWHINYGGTAL
LWREGCIIRSRFLGNIRDAYEANPDLIFLGSDAYFKGILENSLGEWRKVVAKSIEVGIPM
PCMASAITFLDSYTSERLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNWTGRGGDAAST
TYDV
Download sequence
Identical sequences A0A1D2NXF7 Q9CKQ2
272843.PM1554 gi|15603419|ref|NP_246493.1| gi|386835428|ref|YP_006240746.1| WP_005752107.1.11014 WP_005752107.1.11214 WP_005752107.1.11947 WP_005752107.1.12156 WP_005752107.1.12311 WP_005752107.1.14908 WP_005752107.1.15732 WP_005752107.1.17980 WP_005752107.1.19996 WP_005752107.1.21657 WP_005752107.1.24757 WP_005752107.1.26777 WP_005752107.1.27592 WP_005752107.1.28084 WP_005752107.1.35562 WP_005752107.1.3807 WP_005752107.1.38246 WP_005752107.1.3839 WP_005752107.1.3957 WP_005752107.1.40210 WP_005752107.1.40787 WP_005752107.1.41297 WP_005752107.1.41351 WP_005752107.1.41657 WP_005752107.1.41667 WP_005752107.1.42469 WP_005752107.1.42512 WP_005752107.1.43687 WP_005752107.1.45422 WP_005752107.1.4808 WP_005752107.1.49053 WP_005752107.1.51342 WP_005752107.1.52585 WP_005752107.1.52859 WP_005752107.1.53852 WP_005752107.1.55074 WP_005752107.1.55401 WP_005752107.1.57956 WP_005752107.1.58111 WP_005752107.1.58257 WP_005752107.1.60478 WP_005752107.1.61098 WP_005752107.1.6219 WP_005752107.1.62389 WP_005752107.1.6332 WP_005752107.1.63549 WP_005752107.1.66990 WP_005752107.1.72215 WP_005752107.1.78987 WP_005752107.1.79347 WP_005752107.1.79593 WP_005752107.1.81885 WP_005752107.1.8281 WP_005752107.1.83579 WP_005752107.1.88402 WP_005752107.1.89773 WP_005752107.1.90578 WP_005752107.1.92478 WP_005752107.1.93940 WP_005752107.1.94432 WP_005752107.1.9746 WP_005752107.1.9947 gi|383311405|ref|YP_005364215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]