SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005768924.1.15899 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005768924.1.15899
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.56e-34
Family N-acetyl transferase, NAT 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005768924.1.15899
Sequence length 145
Comment ribosomal-protein-alanine N-acetyltransferase RimI [Coxiella burnetii]; AA=GCF_002247285.1; RF=na; TAX=777; STAX=777; NAME=Coxiella burnetii; strain=Ohio 314 RSA270; AL=Scaffold; RT=Major
Sequence
MKIRNWIKDDVPQVSEIAEAAMPFPWSEKFFYDCLKSNYYGWVMESDHHLVGFIVILMQE
KECQLMNIAVAPRYQRKGVASQLLQHALHYAKTHHATRLLLEVRKSNRSAIEFYKKAGGV
EIGVRKNYYPAEKGREDALVFNLNF
Download sequence
Identical sequences A0A2K2E6K6 A9KFF8 Q83DD7
NP_819821.1.72601 WP_005768924.1.11896 WP_005768924.1.15899 WP_005768924.1.18645 WP_005768924.1.18990 WP_005768924.1.20088 WP_005768924.1.25364 WP_005768924.1.29693 WP_005768924.1.31144 WP_005768924.1.35092 WP_005768924.1.38839 WP_005768924.1.39746 WP_005768924.1.41753 WP_005768924.1.43615 WP_005768924.1.44545 WP_005768924.1.460 WP_005768924.1.513 WP_005768924.1.53098 WP_005768924.1.55037 WP_005768924.1.55635 WP_005768924.1.56161 WP_005768924.1.57074 WP_005768924.1.68745 WP_005768924.1.68840 WP_005768924.1.7296 WP_005768924.1.73073 WP_005768924.1.74283 WP_005768924.1.85884 WP_005768924.1.88235 WP_005768924.1.8942 WP_005768924.1.92481 WP_005768924.1.96664 WP_005768924.1.9866 WP_005768924.1.99156 gi|29654129|ref|NP_819821.1| gi|161830175|ref|YP_001596898.1| 227377.CBU_0801 360115.COXBURSA331_A1148 434922.CBUD_0868 434924.CbuK_0670 gi|154707659|ref|YP_001424252.1| gi|212218285|ref|YP_002305072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]