SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005788720.1.11335 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005788720.1.11335
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005788720.1.11335
Sequence length 101
Comment MULTISPECIES: anti-sigma factor antagonist [Bacteroides]; AA=GCF_000263115.1; RF=na; TAX=997882; STAX=817; NAME=Bacteroides fragilis CL07T00C01; strain=CL07T00C01; AL=Scaffold; RT=Major
Sequence
MEKYEIHFVGSVLDSNTSGDEQAKIVALIEQGHSVALDLSGCSYVSSAGLRVMLYAFKLA
KAKSRDVCLVGVSQEVKDVMHMTGFDKFFRFYQTLDELSQP
Download sequence
Identical sequences A0A015U744 A0A015VDH0 A0A015X8H2 A0A016BTB2 A0A016DGM5 A0A016E6C4 A0A017NFT2 A0A0E2A9W1 A0A0E2ALG9 A0A0E2RJZ4 A0A139TC07 A0A149NFL0 D1JTJ1 F7LW06 I9V385 Q5LBI3
272559.BF2843 gi|60682313|ref|YP_212457.1| WP_005788720.1.10040 WP_005788720.1.11335 WP_005788720.1.15557 WP_005788720.1.18542 WP_005788720.1.2011 WP_005788720.1.21107 WP_005788720.1.21908 WP_005788720.1.23698 WP_005788720.1.26260 WP_005788720.1.26934 WP_005788720.1.30158 WP_005788720.1.30608 WP_005788720.1.31541 WP_005788720.1.33107 WP_005788720.1.37052 WP_005788720.1.37988 WP_005788720.1.38746 WP_005788720.1.40404 WP_005788720.1.4066 WP_005788720.1.43770 WP_005788720.1.44936 WP_005788720.1.456 WP_005788720.1.50677 WP_005788720.1.51763 WP_005788720.1.53885 WP_005788720.1.53995 WP_005788720.1.55270 WP_005788720.1.56204 WP_005788720.1.57121 WP_005788720.1.58084 WP_005788720.1.60854 WP_005788720.1.6251 WP_005788720.1.63108 WP_005788720.1.63590 WP_005788720.1.65409 WP_005788720.1.65726 WP_005788720.1.65921 WP_005788720.1.69826 WP_005788720.1.75176 WP_005788720.1.75668 WP_005788720.1.77492 WP_005788720.1.85293 WP_005788720.1.89424 WP_005788720.1.89499 WP_005788720.1.89819 WP_005788720.1.91045 WP_005788720.1.91849 WP_005788720.1.93759 WP_005788720.1.9461 WP_005788720.1.95750 WP_005788720.1.97349 WP_005788720.1.97365 WP_005788720.1.98903 WP_005788720.1.9932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]