SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005791976.1.43770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005791976.1.43770
Domain Number 1 Region: 239-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.94e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.045
Further Details:      
 
Domain Number 2 Region: 15-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 3 Region: 507-615
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.42e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005791976.1.43770
Sequence length 616
Comment MULTISPECIES: MFS transporter [Bacteroides]; AA=GCF_000599345.1; RF=na; TAX=1339328; STAX=817; NAME=Bacteroides fragilis str. S36L12; strain=S36L12; AL=Contig; RT=Major
Sequence
MADEMMVKELEEVVVRFSGDSGDGMQLAGNIFSNVSATVGNDICTFPDYPADIRAPQGSL
TGVSGFQVHVGASKIFTPGDHCHVLVAMNPAALKTQIKFCKPQGLVITDSDSFGEKDLEK
AQFKTGNPFEEMGITQQVLEVPISSMCKESLKDSGLDNKAMLRCKNMFALGLVCWLFNRN
LSAAEKMLNEKFAKKPEIAAANIKVLNDGYNYGANTHASTSTYKIESKTPKAAGLYTDIN
GNKATSYGLIAAAEKAGLELYLGSYPITPATDILHELAKHKSLGVKTVQCEDEIAGCASA
VGAAFAGDLAVTTTSGPGVCLKSEAMNLAVIAELPLVVVNVQRGGPSTGMPTKSEQTDLL
QALYGRNGESPMPVIAATSPTNCFDAAYMAAKIALEHMTPVVLLTDAFIANGSAAWKLPN
MDEYPAINPPYVTPDMIGTWTPFQRNEKTGVRYWAVPGTEGFMHRIGGLEKSSETGVIST
EPENHQKMTLLRQAKVDKIADSIPEQEVQGDADADLLVVGWGGTYGHLYSAVEHMRKNGK
KVALAHFQYINPLPKNTAEILKKYKKIVVAEQNLGQFAGYLRMKVPGLNISQFNQVKGQP
FVTRELVEAFTKLLEE
Download sequence
Identical sequences A0A015TIK9 A0A015V550 A0A015VI79 A0A015W7K1 A0A015Y372 A0A016BQX8 A0A016DBS4 A0A016EFL5 A0A016FTL6 A0A016H2F4 A0A017N4K6 A0A0E2A6E7 A0A0E2RYS5 A0A0E2SNV0 A0A0E2T1Z9 A0A1C0W5T3 E1WRG5 I9VBL7 K1FZ28 Q64MW0 R6Z770
WP_005791976.1.100686 WP_005791976.1.101046 WP_005791976.1.10405 WP_005791976.1.15557 WP_005791976.1.2011 WP_005791976.1.21107 WP_005791976.1.21713 WP_005791976.1.21908 WP_005791976.1.23698 WP_005791976.1.26832 WP_005791976.1.26934 WP_005791976.1.30158 WP_005791976.1.30608 WP_005791976.1.31541 WP_005791976.1.32651 WP_005791976.1.34692 WP_005791976.1.35533 WP_005791976.1.35818 WP_005791976.1.36984 WP_005791976.1.37052 WP_005791976.1.38746 WP_005791976.1.39779 WP_005791976.1.40326 WP_005791976.1.40404 WP_005791976.1.4066 WP_005791976.1.43770 WP_005791976.1.44936 WP_005791976.1.46679 WP_005791976.1.48703 WP_005791976.1.49420 WP_005791976.1.50677 WP_005791976.1.50935 WP_005791976.1.51373 WP_005791976.1.5142 WP_005791976.1.51489 WP_005791976.1.51763 WP_005791976.1.52936 WP_005791976.1.53885 WP_005791976.1.53910 WP_005791976.1.54019 WP_005791976.1.56204 WP_005791976.1.57121 WP_005791976.1.60699 WP_005791976.1.60854 WP_005791976.1.63108 WP_005791976.1.63590 WP_005791976.1.63925 WP_005791976.1.65409 WP_005791976.1.65726 WP_005791976.1.65921 WP_005791976.1.66858 WP_005791976.1.66941 WP_005791976.1.69826 WP_005791976.1.73957 WP_005791976.1.75176 WP_005791976.1.75668 WP_005791976.1.7580 WP_005791976.1.76253 WP_005791976.1.77492 WP_005791976.1.78347 WP_005791976.1.85293 WP_005791976.1.89424 WP_005791976.1.89499 WP_005791976.1.91045 WP_005791976.1.91849 WP_005791976.1.93759 WP_005791976.1.9461 WP_005791976.1.94953 WP_005791976.1.95091 WP_005791976.1.95195 WP_005791976.1.97365 WP_005791976.1.98903 WP_005791976.1.9932 YP_101711.1.45732 gi|375360488|ref|YP_005113260.1| gi|53715719|ref|YP_101711.1| 295405.BF4440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]