SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005805164.1.2426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005805164.1.2426
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.06e-37
Family Ribosomal protein L6 0.00004
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.6e-21
Family Ribosomal protein L6 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005805164.1.2426
Sequence length 180
Comment MULTISPECIES: 50S ribosomal protein L6 [Candidatus Arthromitus]; AA=GCF_000284435.1; RF=na; TAX=1041809; STAX=49118; NAME=Candidatus Arthromitus sp. SFB-mouse-Yit; strain=SFB-mouse-Yit; AL=Complete Genome; RT=Major
Sequence
MSRVGRLPIILPEGTLVNIDSNNFITVQGKKGKLEKQMSSDIIIRQEESQIFVERKNETK
KQKQLHGLTRALIFNMVKGVSEGYSKTLELNGVGYRAQLKGKNIVMNLGYSHPVEINSVD
GIIFEVPNQTQIIVSGIDKQLVGEVAAKIRQWRKPEPYKGKGIKYSDEIIRRKEGKTGKK
Download sequence
Identical sequences F9VLY2
gi|384456411|ref|YP_005669009.1| WP_005805164.1.2397 WP_005805164.1.2426 WP_005805164.1.26273 WP_005805164.1.4915 gi|342733043|ref|YP_004771882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]