SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005858009.1.61673 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005858009.1.61673
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.67e-34
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 112-324
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.78e-21
Family alpha-mannosidase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005858009.1.61673
Sequence length 962
Comment hypothetical protein [Parabacteroides distasonis]; AA=GCF_002257605.1; RF=na; TAX=2025876; STAX=2025876; NAME=Parabacteroides sp. CT06; strain=CT06; AL=Complete Genome; RT=Major
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDVKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSRKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEETMVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPAEQIARLKQRVKEGRIELATMYLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYNQ
GNFFGIHTDDFEQFEERVLAYLDQMEAKNYPYDILAAQHSGYFTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADRIETIRGAWPDWWTDGFGSGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIQDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDAAGNVIPAQAGESRSDGTYWNFYVKEVPALGYAQYYIKVKDAPRPEIQGTT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETIAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVTSDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences A0A223HKR6
WP_005858009.1.61673 WP_005858009.1.98975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]