SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_005866414.1.38556 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005866414.1.38556
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.29e-33
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 112-323
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.23e-21
Family alpha-mannosidase 0.045
Further Details:      
 
Weak hits

Sequence:  WP_005866414.1.38556
Domain Number - Region: 58-130
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.0611
Family Ribosome recycling factor, RRF 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005866414.1.38556
Sequence length 962
Comment MULTISPECIES: hypothetical protein [Parabacteroides]; AA=GCF_000307435.1; RF=na; TAX=999417; STAX=823; NAME=Parabacteroides distasonis CL09T03C24; strain=CL09T03C24; AL=Scaffold; RT=Major
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDVKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIHLGEQSHKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEETTVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEQLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPVEQIARLKQRVKEGRIELATMFLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYHY
GNFFGIHTDNFDQFEERVLTYLGEMEAKNYPYDILAVQHSGYLTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADHIQTIRGAWPDWWTDGFASGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPKDINDRIQDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDAAGNVIPAQAGESRSDGTYWSFYVKDVPALGYAQYYIKVKDAPRPEIQGAT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
AESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVASDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences E1YSL6 K5ZGC4
WP_005866414.1.38556 WP_005866414.1.725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]