SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005904134.1.20223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005904134.1.20223
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.5e-34
Family Ribosomal protein L6 0.000065
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.46e-29
Family Ribosomal protein L6 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005904134.1.20223
Sequence length 177
Comment 50S ribosomal protein L6 [Fusobacterium nucleatum]; AA=GCF_002211605.1; RF=na; TAX=76856; STAX=851; NAME=Fusobacterium nucleatum subsp. nucleatum; strain=ChDC F317; AL=Complete Genome; RT=Major
Sequence
MSRVGKKPIAVPSGVDFSVKDNVVTVKGPKGTLTKEFNNNITIKLEDGHITVERPNDEPF
MRAIHGTTRALINNMVKGVHEGYRKTLTLVGVGYRAATKGKGLEISLGYSHPVIIDEIPG
ITFSVEKNTTIHIDGVEKELVGQVAANIRAKRPPEPYKGKGVKYADEHIRRKEGKKS
Download sequence
Identical sequences A0A101K6R8 D5RFB4 Q8RIH1
gi|19704950|ref|NP_602445.1| 190304.FN1629 NP_602445.1.20138 WP_005904134.1.20223 WP_005904134.1.29770 WP_005904134.1.33975 WP_005904134.1.7230 WP_005904134.1.73842 WP_005904134.1.94488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]