SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006056869.1.71935 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006056869.1.71935
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Globin-like 3.81e-35
Family Truncated hemoglobin 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006056869.1.71935
Sequence length 125
Comment globin [Halogeometricum borinquense]; AA=GCF_000337855.1; RF=na; TAX=469382; STAX=60847; NAME=Halogeometricum borinquense DSM 11551; strain=DSM 11551; AL=Contig; RT=Major
Sequence
MSDQTLYRRLGGRDALASVVDTFYDRILADDELRPFFEDVDMTKQRAHQTQFLSAVAGGP
VEYDGENMAAAHEHLDITHEEYDAIAAHLDAALEIHDVPADDRETVLTAVESFRDDIVTI
DASPA
Download sequence
Identical sequences E4NPK6
gi|313126851|ref|YP_004037121.1| WP_006056869.1.71935 WP_006056869.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]