SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006057069.1.71935 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006057069.1.71935
Domain Number 1 Region: 20-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.38e-23
Family GHMP Kinase, N-terminal domain 0.0044
Further Details:      
 
Weak hits

Sequence:  WP_006057069.1.71935
Domain Number - Region: 229-255
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0106
Family Homoserine kinase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006057069.1.71935
Sequence length 299
Comment shikimate kinase [Halogeometricum borinquense]; AA=GCF_000337855.1; RF=na; TAX=469382; STAX=60847; NAME=Halogeometricum borinquense DSM 11551; strain=DSM 11551; AL=Contig; RT=Major
Sequence
MHGRAVALGAGTILNALSTGVGSAFAIDAETTATVELDDSESVRGSVAEDADADTRLIER
CVELAVERYGDDEYGGTVRTESDVPMAAGLKSSSAAANATVLATADALGVEPDREEACRL
GVQAARDVGVTITGAFDDASASMLGGATVTNNDDDELLSREPVEWDVLVWTPDERAYSAD
ADVESCANVAPMAELVAELALDGRYAEAMTVNGLAFSAALDFPTDPAVEAMPHAAGVSLS
GTGPSVVAVAERGSAAHQTESGDVDDGDESPLKRLRDLWAKRDGRTWLTTTRNDGASIR
Download sequence
Identical sequences E4NND7
gi|313126650|ref|YP_004036920.1| WP_006057069.1.71935 WP_006057069.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]