SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006079949.1.76213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006079949.1.76213
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.92e-124
Family UbiD middle domain-like 0.000000000268
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.44e-68
Family UbiD C-terminal domain-like 0.0000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006079949.1.76213
Sequence length 493
Comment MULTISPECIES: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Shewanella]; AA=GCF_000231345.1; RF=na; TAX=693972; STAX=62322; NAME=Shewanella baltica OS625; strain=OS625; AL=Contig; RT=Major
Sequence
MSFKDLRSFIDHLEANGELKRISYPVDPHLEMTEIADRVLRAKGPALLFENPKDHHMPVL
VNLFGTPKRVAMALGKDDPLALREVGELLAFLKEPEPPRGFKDAIAKIPMFKQALNMPPK
TVRNPPCQQVIKTGDEVDLTQLPIQHCWPGDVAPLVTWGLTITKGPRKSRQNLGIYRQQL
LGKNKLIMRWLSHRGGALDFADFKQQFPGERYPVVVALGADPVTILGAVTPVPDSMSEYA
FAGLLRGERTEVCKALSCDLEVPATSEIILEGYIDPEELAEEGPYGDHTGYYNETDKFPV
FTVTHITHRKDAIYHSTYTGRPPDEPAMLGVALNEVFVPILRKQYPEIVDFYLPPEGCSY
RMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIVIVDEDVNCRDWQDVIWAITTRMDP
KRDTVMIENTPIDYLDFASPVAGLGSKMGLDATNKWEGETNREWGTPIVMDPKVKQKIDS
IWDELGIDDSPTL
Download sequence
Identical sequences A0A165JNE6 A9L4M9 B8E5Z9 G0AR65
gi|217974952|ref|YP_002359703.1| WP_006079949.1.19221 WP_006079949.1.24904 WP_006079949.1.35668 WP_006079949.1.35710 WP_006079949.1.60405 WP_006079949.1.74325 WP_006079949.1.76213 WP_006079949.1.93117 gi|386326195|ref|YP_006022312.1| gi|378710304|ref|YP_005275198.1| 399599.Sbal195_3985 407976.Sbal223_3803 gi|160877089|ref|YP_001556405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]