SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006082098.1.35710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006082098.1.35710
Domain Number - Region: 5-86
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0246
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006082098.1.35710
Sequence length 119
Comment MULTISPECIES: DUF2750 domain-containing protein [Shewanella]; AA=GCF_001887095.2; RF=na; TAX=1873135; STAX=1873135; NAME=Shewanella sp. SACH; strain=SACH; AL=Scaffold; RT=Major
Sequence
MTEINAALAGFIKNVKQHQTLWGLMDETGEGWVVCDSSEFEDTDVMPLWSSEATAKSHCS
DEWHDYQPVAISLEEFLEYWVSDLNDDGVLIGVDWQTDEDCLELDPIVLAKDLVDVEEV
Download sequence
Identical sequences A0A165K900 A3D5S2 B8E6Y6 G0AV62
gi|386341559|ref|YP_006037925.1| WP_006082098.1.19221 WP_006082098.1.24904 WP_006082098.1.35668 WP_006082098.1.35710 WP_006082098.1.74325 WP_006082098.1.8014 WP_006082098.1.86146 325240.Sbal_2592 407976.Sbal223_1754 gi|217972931|ref|YP_002357682.1| gi|126174805|ref|YP_001050954.1| gi|386324202|ref|YP_006020319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]