SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006082493.1.76213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006082493.1.76213
Domain Number - Region: 29-72
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0432
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006082493.1.76213
Sequence length 100
Comment MULTISPECIES: hypothetical protein [Shewanella]; AA=GCF_000231345.1; RF=na; TAX=693972; STAX=62322; NAME=Shewanella baltica OS625; strain=OS625; AL=Contig; RT=Major
Sequence
MMAKWVKLAAVATLALGMSSAWAQGVTHEGTVVDTMNGGGYTYVQIKEADTTFWAAGPQT
EVSKGDKVAVVEQMWMNEFTSKTLNRTFDKLLFVGQIDKK
Download sequence
Identical sequences A0A165K7H7 A9KXL9 G0AQU8
WP_006082493.1.19221 WP_006082493.1.24904 WP_006082493.1.35668 WP_006082493.1.35710 WP_006082493.1.60405 WP_006082493.1.76213 WP_006082493.1.76739 WP_006082493.1.85636 WP_006082493.1.93117 gi|160876265|ref|YP_001555581.1| gi|386323810|ref|YP_006019927.1| gi|153001529|ref|YP_001367210.1| gi|378709465|ref|YP_005274359.1| 399599.Sbal195_3159 402882.Shew185_3016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]