SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006132815.1.55588 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006132815.1.55588
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily L21p-like 6.28e-31
Family Ribosomal protein L21p 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006132815.1.55588
Sequence length 106
Comment MULTISPECIES: 50S ribosomal protein L21 [Actinobacteria]; AA=GCF_000719105.1; RF=na; TAX=1957; STAX=1957; NAME=Streptomyces sclerotialus; strain=NRRL B-2317; AL=Contig; RT=Major
Sequence
MYAIVRSGGRQHKVAVGDIVEVDKISTAKVGDTVELSTLLVVDGDSVTSDPWVLAGIKVQ
AEVVDHHKGQKIDILRYKNKTGYRRRQGHRQQYTAIKVTEIPAAAK
Download sequence
Identical sequences A0A0S2P019 A0A0U3QXX9 A0A101QM03 A0A1C4MRY5 A0A2K2RM81 H2K760 M3BVP3
gi|474982388|ref|YP_007692854.1| gi|386840177|ref|YP_006245235.1| WP_006132815.1.101356 WP_006132815.1.101478 WP_006132815.1.21199 WP_006132815.1.24026 WP_006132815.1.28171 WP_006132815.1.36222 WP_006132815.1.39691 WP_006132815.1.42131 WP_006132815.1.43305 WP_006132815.1.45632 WP_006132815.1.47098 WP_006132815.1.54926 WP_006132815.1.55588 WP_006132815.1.57224 WP_006132815.1.67221 WP_006132815.1.69621 WP_006132815.1.81471 WP_006132815.1.8165 WP_006132815.1.88765 WP_006132815.1.94752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]