SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006180983.1.15549 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006180983.1.15549
Domain Number - Region: 8-82
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0425
Family Diacylglycerol kinase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006180983.1.15549
Sequence length 122
Comment hypothetical protein [Natrinema pellirubrum]; AA=GCF_000230735.2; RF=representative genome; TAX=797303; STAX=69525; NAME=Natrinema pellirubrum DSM 15624; strain=DSM 15624; AL=Complete Genome; RT=Major
Sequence
MQRRQFLAAAATLAALPQAATADTGRAEEIVEDRSVTDDGTYSITDCGSVPGGLNNVHVT
ADMNDGPLEVEGVHEENGWSGVDLRWSSGPIEVGTGLDPDDARDLAARLVVAADAAEGEF
DD
Download sequence
Identical sequences L0JSS3
WP_006180983.1.15549 WP_006180983.1.24189 gi|433593381|ref|YP_007296122.1| gi|433593381|ref|YP_007296122.1|NC_019967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]