SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006191289.1.73955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006191289.1.73955
Domain Number - Region: 109-144
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0471
Family Phase 1 flagellin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006191289.1.73955
Sequence length 147
Comment flagellar basal body rod protein FlgC [Selenomonas sputigena]; AA=GCF_000208405.1; RF=representative genome; TAX=546271; STAX=69823; NAME=Selenomonas sputigena ATCC 35185; strain=ATCC 35185; AL=Complete Genome; RT=Major
Sequence
MSMFGGIDASASGLTAERLRMDVISNNIANANTTRSVEGGPYHRRYVVFQPRERGKEDFA
STLRQKLDNQAGNGVRAMKIEEDRSQGPLVYDPGHPDANADGYVERPNINIVQEMVDMIT
ASRAYEANVTAINAAKGMAQNALNIGK
Download sequence
Identical sequences C9LSN2
gi|330839539|ref|YP_004414119.1| WP_006191289.1.43677 WP_006191289.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]