SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006191748.1.43677 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006191748.1.43677
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.64e-35
Family Ribosomal protein L6 0.0000407
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.08e-27
Family Ribosomal protein L6 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006191748.1.43677
Sequence length 183
Comment 50S ribosomal protein L6 [Selenomonas sputigena]; AA=GCF_000160495.1; RF=na; TAX=546271; STAX=69823; NAME=Selenomonas sputigena ATCC 35185; strain=ATCC 35185; AL=Scaffold; RT=Major
Sequence
MSRIGRAPIEIPAGVTVKIEEVNKVTVKGPKGELFRELHPDMKIAVEGNVLTVTRPSDDK
EHRSLHGLTRTLINNMVVGVTEGFKKTLEINGVGYRAAKQGKNLNLSLGFSHPVIVEPPA
GITLDAPSATSIVVSGIDKEAVGAIAAKIRSYRLPEPYKGKGIKYEGEHIRRKVGKAGAK
AKK
Download sequence
Identical sequences C9LTE4
WP_006191748.1.43677 WP_006191748.1.73955 gi|330839311|ref|YP_004413891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]