SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006249068.1.22107 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006249068.1.22107
Domain Number 1 Region: 205-371
Classification Level Classification E-value
Superfamily Colicin 0.000000000102
Family Colicin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006249068.1.22107
Sequence length 379
Comment hypothetical protein [Mannheimia haemolytica]; AA=GCF_000422095.1; RF=na; TAX=1311760; STAX=75985; NAME=Mannheimia haemolytica D174; strain=D174; AL=Complete Genome; RT=Major
Sequence
MSTTLNEINITELDAGPEIKSLSLNDAVNSFLNDSACPICGKNCQYWQRLKRSLNRKENQ
GKGDKVLVKNPSPISIEKNLINAYKEYRKFEEDLKDKIHSQESIYDLKLAKELFHSYTNL
ASHLSLEQDKNHFNDKALLKNYPDSLKSALVLAEWTKEYHGKYDNFINDIKSDNWTSAAI
NFHLGMEKVPLNDLIYKEIYNYWDKTSLKDESERIISASIEFSNYFANKYSENIEEGIKN
AEKEFKKNYNKSLRYNAKKAQQRVQKYVEKVNQKNPQALKDLDNISNLKKINENLKKAAK
FTGIISSIKDYYDLAEGFRNGIKSNDWEPFLKTSAQIGASALMSMLVASMITGPTTIGSI
IISAAFISIGGYIISLASR
Download sequence
Identical sequences A0A0B5BU56 A0A249A210 M9X0R9
gi|525664591|ref|YP_008223605.1| gi|472334622|ref|YP_007666897.1| gi|472335878|ref|YP_007668152.1| WP_006249068.1.100578 WP_006249068.1.101281 WP_006249068.1.14651 WP_006249068.1.15850 WP_006249068.1.18032 WP_006249068.1.21690 WP_006249068.1.22107 WP_006249068.1.24300 WP_006249068.1.27302 WP_006249068.1.2785 WP_006249068.1.28573 WP_006249068.1.29735 WP_006249068.1.34159 WP_006249068.1.42410 WP_006249068.1.42606 WP_006249068.1.43708 WP_006249068.1.45083 WP_006249068.1.47009 WP_006249068.1.50719 WP_006249068.1.52776 WP_006249068.1.61638 WP_006249068.1.62250 WP_006249068.1.63192 WP_006249068.1.63974 WP_006249068.1.73398 WP_006249068.1.73782 WP_006249068.1.73864 WP_006249068.1.74727 WP_006249068.1.74925 WP_006249068.1.76946 WP_006249068.1.78880 WP_006249068.1.8019 WP_006249068.1.802 WP_006249068.1.81289 WP_006249068.1.82341 WP_006249068.1.84529 WP_006249068.1.90102 WP_006249068.1.91740 WP_006249068.1.93146 WP_006249068.1.94296 WP_006249068.1.95739 gi|525703289|ref|YP_008235070.1| gi|526468031|ref|YP_008338149.1| gi|482885878|ref|YP_007883051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]