SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006318320.1.95373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006318320.1.95373
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-39
Family Frataxin-like 0.00000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006318320.1.95373
Sequence length 106
Comment MULTISPECIES: iron donor protein CyaY [Serratia]; AA=GCF_000300895.1; RF=na; TAX=1206776; STAX=82996; NAME=Serratia plymuthica A30; strain=A30; AL=Contig; RT=Major
Sequence
MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTKIVINRQEPLHQV
WLATKTGGYHFNYRDGAWFCDRSDRGFYPLLSEAASAQAGEDVHFA
Download sequence
Identical sequences A0A1B1KJR1
WP_006318320.1.100617 WP_006318320.1.22336 WP_006318320.1.28294 WP_006318320.1.55341 WP_006318320.1.72308 WP_006318320.1.85867 WP_006318320.1.87098 WP_006318320.1.91790 WP_006318320.1.95373 gi|333925033|ref|YP_004498612.1| gi|386326857|ref|YP_006023027.1| gi|333929986|ref|YP_004503564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]