SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006385101.1.41422 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006385101.1.41422
Domain Number - Region: 87-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00131
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006385101.1.41422
Sequence length 147
Comment membrane protein [Stenotrophomonas maltophilia]; AA=GCF_001693455.1; RF=na; TAX=40324; STAX=40324; NAME=Stenotrophomonas maltophilia; strain=SBo1; AL=Contig; RT=Major
Sequence
MRWEVVGWGALALLLFAAEALAPGAFMLWIGIGAAAVFVLVAVFGDIPLLWQVVAFVLLS
VVSIQCYRRWGRPRARPSDAPLLNRRTEQLIGRVVALQQGIVDGHGRVSIDDASWQVTGP
ELPAGAWVKVLSVQGTVLVVEAAGRPL
Download sequence
Identical sequences A0A2J0UM55 B4SSE1 M5D1L6
391008.Smal_3074 gi|194366846|ref|YP_002029456.1| WP_006385101.1.100705 WP_006385101.1.41422 WP_006385101.1.52398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]