SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006411141.1.38686 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006411141.1.38686
Domain Number 1 Region: 15-287
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.3e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000187
Further Details:      
 
Domain Number 2 Region: 288-310,356-444
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 8.5e-21
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006411141.1.38686
Sequence length 459
Comment MULTISPECIES: cytochrome b [Burkholderia]; AA=GCF_001530985.1; RF=na; TAX=87883; STAX=87883; NAME=Burkholderia multivorans; strain=MSMB1916WGS; AL=Contig; RT=Major
Sequence
MADNKEVSTTGLTGWIDQRFPLTTTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQIVTG
IFLTMNYKPDSMLAFASVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLMYGSYR
KPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIRG
DYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSNNPDGIEIKAKKDANGIPLD
GIPFHPYYSVHDFFGVCVFLMVFALIVFFAPEMGGYFLESNNFVPANPLQTPPEIAPVWY
FTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWKIGLPVLAAAIVVFMYLTESKF
WGVVVMGSAVITLFFLPWLDRSPVKSIRYRPLFHKVFLGIFVAAFLTLAFLGTRPPSPAA
TLIAQGCALIYFAFFLGMPVWTPLGTFKQPPERVRFKPH
Download sequence
Identical sequences A0A0H3KML5 A0A1B4MQW1 J4SNR6
gi|189351702|ref|YP_001947330.1| WP_006411141.1.100558 WP_006411141.1.101207 WP_006411141.1.23373 WP_006411141.1.24798 WP_006411141.1.37770 WP_006411141.1.38686 WP_006411141.1.4927 WP_006411141.1.54573 WP_006411141.1.66697 WP_006411141.1.84428 gi|189351702|ref|YP_001947330.1| 395019.Bmul_0345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]