SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006482039.1.10541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006482039.1.10541
Domain Number 1 Region: 115-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-59
Family D-glucarate dehydratase-like 0.00046
Further Details:      
 
Domain Number 2 Region: 9-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.5e-26
Family Enolase N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006482039.1.10541
Sequence length 366
Comment MULTISPECIES: mandelate racemase [Burkholderia cepacia complex]; AA=GCF_001992115.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC7985; AL=Contig; RT=Major
Sequence
MALSAAPAIDDVRARAYRVPTDRPEADGTYAWTATTVVVVEIDAGPVTGLGYTYTDASAV
PLVTSLLAGVLRNRPVVDIPAAVDALWRAVRNVGRGGIAATAISALDAALWDAKAKLADV
PLALLLGRLRERVPVYGSGGFTTYDAPTLAAQLDGWRAGHVRACKIKIGVDDARDPSRVR
AARDALGPGVDLFVDANGAYAPRTALAFAQAAADCDIRWFEEPVSSDDVDGLRFVREHVG
ARVDIAAGEYAYTPDDFRRLLEGHAVDVLQADATRCGGVSGFLAAAALADAHHVDLSAHC
APALHRHIGCAAARLRHIEWFHDHVRIERMLFDGAPMLVDGALEIDATRAGLGLELRAAD
LLDLAL
Download sequence
Identical sequences A0A1V2X2L8 B4ENN0
WP_006482039.1.100706 WP_006482039.1.101897 WP_006482039.1.10541 WP_006482039.1.11355 WP_006482039.1.14088 WP_006482039.1.22015 WP_006482039.1.25261 WP_006482039.1.27304 WP_006482039.1.27889 WP_006482039.1.27910 WP_006482039.1.29408 WP_006482039.1.31157 WP_006482039.1.31547 WP_006482039.1.33877 WP_006482039.1.40288 WP_006482039.1.45869 WP_006482039.1.52424 WP_006482039.1.52705 WP_006482039.1.55547 WP_006482039.1.57568 WP_006482039.1.60885 WP_006482039.1.64618 WP_006482039.1.66306 WP_006482039.1.67642 WP_006482039.1.69134 WP_006482039.1.70783 WP_006482039.1.71578 WP_006482039.1.71688 WP_006482039.1.72171 WP_006482039.1.7270 WP_006482039.1.75651 WP_006482039.1.79353 WP_006482039.1.82360 WP_006482039.1.83528 WP_006482039.1.85579 WP_006482039.1.86231 WP_006482039.1.87780 WP_006482039.1.87798 WP_006482039.1.95790 WP_006482039.1.98001 WP_006482039.1.99008 gi|197295328|ref|YP_002153869.1| 216591.BCAS0484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]