SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006491074.1.87780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006491074.1.87780
Domain Number 1 Region: 39-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.77e-28
Family C-terminal domain of adrenodoxin reductase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006491074.1.87780
Sequence length 486
Comment MULTISPECIES: FAD-dependent oxidoreductase [Burkholderia cepacia complex]; AA=GCF_001993315.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC13356; AL=Contig; RT=Major
Sequence
MTSQLDALEARLAQDLRWLDLPAPSWVPSREADGVRVLDVAIVGGGMAGLAASAELRLLG
IDNQCVIDRAPAGYEGPWVTFARMETLRSPKQLAGPALGLPALTFRAWFEAQYGRDAWDA
LYKIPRPQWMDYLRWYRRVLDLQVRNDTTLVALRPRDDGLLALDVRGNGEAQTLLARHVV
LATGRDGLGGPYVPPVAQRAPRTRWAHSSEPIDFAALAGKRVGVVGAGASAFDNAGTALE
AGAARVDLFFRRADIPRINKLTGIGSPGLVHGYADLDDATKWRFMHYALTSQTPPPRDSV
LRVSRHDHAHFHAGSPIETLADHADGLEVTTPRGRYTVDFLIFATGFHSDWTTRDEFASF
GAHVRRWKDRYQPDPALRLDELAESPDLGPAFAFQERERGACPAVTRIHCFNHAASLSHG
KLSGDIPAISAGAERLARGIASRLFDADRDRHYDALVAYANAELQGDEWRDADALDHFDD
EGTPKR
Download sequence
Identical sequences A0A1V2XBY8 B4EL29
216591.BCAM0608 WP_006491074.1.10003 WP_006491074.1.11355 WP_006491074.1.14088 WP_006491074.1.21852 WP_006491074.1.22015 WP_006491074.1.25261 WP_006491074.1.27304 WP_006491074.1.27889 WP_006491074.1.29408 WP_006491074.1.33877 WP_006491074.1.34650 WP_006491074.1.38687 WP_006491074.1.52424 WP_006491074.1.52705 WP_006491074.1.60885 WP_006491074.1.64618 WP_006491074.1.66306 WP_006491074.1.67103 WP_006491074.1.69134 WP_006491074.1.69601 WP_006491074.1.70783 WP_006491074.1.71578 WP_006491074.1.71688 WP_006491074.1.7270 WP_006491074.1.79353 WP_006491074.1.83528 WP_006491074.1.86231 WP_006491074.1.87780 WP_006491074.1.87798 WP_006491074.1.88782 WP_006491074.1.90806 WP_006491074.1.92582 WP_006491074.1.95357 WP_006491074.1.95626 WP_006491074.1.98001 WP_006491074.1.99008 gi|206562469|ref|YP_002233232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]