SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_006797837.1.1498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006797837.1.1498
Domain Number 1 Region: 716-994,1030-1156
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.91e-25
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 327-345,374-626
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000741
Family alpha-mannosidase 0.044
Further Details:      
 
Weak hits

Sequence:  WP_006797837.1.1498
Domain Number - Region: 121-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0287
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006797837.1.1498
Sequence length 1159
Comment glycosyl hydrolase family 38 [Dysgonomonas gadei]; AA=GCF_000213555.1; RF=representative genome; TAX=742766; STAX=156974; NAME=Dysgonomonas gadei ATCC BAA-286; strain=ATCC BAA-286; AL=Scaffold; RT=Major
Sequence
MIRKGFFSLLILVNTIGIYAQSTKVYTQIPSDQIQATASSELQGATAIMAVNSEGMNGDM
HIAHNLGHKMWTSQASTKKVRANEFTREGIVWFMCEIGSNSAPAHIDLIRIWNDNQSQHT
RRGLRKVYIEYSIDGKTWKLLRNNGLDYHVINESKGQNPEPANFTFDTGGIKAKYICFTA
DADGNGNYYDPKDKYIIREAADMQQNVNYYGLSEIRFYKKEDRQISKLTPLNKMSFVASQ
GYLKTDKGPTREYTLKFDAPLFCGGQLDFDINGRKWTENIKPSAIGISVMEGRFPAGYME
ESAEVSVKLRSKQGNLSDSYTVLGARRWNLYFLPHSHLDIGYTHAQDDVMKLQWRNFERA
LELAERTANNPEGSRFKWNSEATWALMGYLDHYKGTEKGDKMIQAIKDGIIGVDASLGSI
LTGICKQEELTHMFDDAHRISGLTGVEFNTAMMSDVPGQSWGMVTAMAQNGVKYYSSGPN
YVPFYGKVGNDRAAHLHVKWGDKPFYWLSQSGKEKVLFWQTGRGYSWFHGWLINRLSACG
VTPIWEYLTDLESKEYPYATTYLRYTVNGDNGPPDQWMPDVIKEWNEKYESPKFYIGTTK
ELFTEFEKQYGDDIPVYGGDITPTWEDGAASTARELAMNRESSERLNQTEILWSMLNPGQ
YPANDFLQAWKNVVLFSEHTWGASASGPEPESEFTKKLWAGKKLYADNADMQSRRLYTDV
FSEIKTAKGGYIHIFNTNLWKRTDVVTIDNDNDLIGKVLESPSGEIVPLQKLHDGRWIFM
AKDIPALSSVAYKITDDKRKKLNVSTMINDNILDNGIIRVEIDKIKGTISSFTKTGEEYN
YASEGGLNDYIYTERYAENPQWVENIKRIIVLDDGEVAATLRVESDAPGCRSLWRDIMVY
KELGRIDILNTIDKENIYKPENVRFIFPFNIDHADIKMDLAMGDMHPERDQLAGVNKNYY
SIQNGISASNLSHGIYLTTIDAPFVELGEMTSDVWRKEGGGLGWWSSALISPKIYSWVMN
NSWRTNYKASQEGIATFRYSLELFDPFDQQLKKQGTEQAQKMIAVVSDKPVGIDNLFRLK
GKNQISVSTIKPSDDGKGYIIRLLNLNDQSVHSSFIWGSMQADEVYFCDHNQQKTGEFED
SSFWLKPYECITLKVISKK
Download sequence
Identical sequences F5ITB5
WP_006797837.1.1498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]